Lus10030256 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004008 81 / 4e-19 AT5G53390 475 / 2e-164 O-acyltransferase (WSD1-like) family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10030256 pacid=23153113 polypeptide=Lus10030256 locus=Lus10030256.g ID=Lus10030256.BGIv1.0 annot-version=v1.0
ATGGAGGAAGTGGGGCTGAGATGGAGAAGAGGCACGAAATCGTCTCTCAAAGTCCAGCATCAAGGCTGTTCCACGAGCCAAACTTCAACGTCTAGCTGTA
CTGGGTTGCAAGACCAAGTTGCCCCTGGCTTCTCCAGTCTCCAGGTTGTAGTCAACGACGGCAATAAAAACAAGGAGAAACACATGAAGTGGGTCCCAAC
AACCGTCAACCTCAAAAACCACGTCATCGTCCCAGACGTAACCAGTCAATCTTCCCCACCTCTGCCGCCGCTGTAG
AA sequence
>Lus10030256 pacid=23153113 polypeptide=Lus10030256 locus=Lus10030256.g ID=Lus10030256.BGIv1.0 annot-version=v1.0
MEEVGLRWRRGTKSSLKVQHQGCSTSQTSTSSCTGLQDQVAPGFSSLQVVVNDGNKNKEKHMKWVPTTVNLKNHVIVPDVTSQSSPPLPPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10030256 0 1
AT2G37370 unknown protein Lus10009063 5.3 0.8564
AT5G40900 Nucleotide-diphospho-sugar tra... Lus10032050 6.6 0.8454
AT4G30720 PDE327 PIGMENT DEFECTIVE 327, FAD/NAD... Lus10010776 6.9 0.8081
Lus10002304 8.8 0.8353
Lus10027520 9.8 0.7745
AT2G37370 unknown protein Lus10025285 11.7 0.8029
AT2G22620 Rhamnogalacturonate lyase fami... Lus10004281 17.2 0.8068
AT4G20040 Pectin lyase-like superfamily ... Lus10008700 20.5 0.7527
Lus10003753 21.2 0.7527
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000682 21.9 0.7527

Lus10030256 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.