Lus10030263 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09870 76 / 2e-18 SAUR-like auxin-responsive protein family (.1)
AT2G28085 56 / 6e-11 SAUR-like auxin-responsive protein family (.1)
AT5G20810 46 / 6e-07 SAUR-like auxin-responsive protein family (.1.2)
AT2G46690 45 / 1e-06 SAUR-like auxin-responsive protein family (.1)
AT4G00880 44 / 4e-06 SAUR-like auxin-responsive protein family (.1)
AT1G19840 43 / 9e-06 SAUR-like auxin-responsive protein family (.1)
AT3G43120 42 / 3e-05 SAUR-like auxin-responsive protein family (.1)
AT2G37030 41 / 3e-05 SAUR-like auxin-responsive protein family (.1)
AT1G75590 41 / 4e-05 SAUR-like auxin-responsive protein family (.1)
AT4G38860 40 / 9e-05 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004014 219 / 4e-75 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
Lus10013819 177 / 5e-58 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Lus10026531 174 / 5e-57 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Lus10023012 129 / 3e-39 AT3G09870 97 / 5e-27 SAUR-like auxin-responsive protein family (.1)
Lus10001398 129 / 7e-39 AT3G09870 97 / 9e-27 SAUR-like auxin-responsive protein family (.1)
Lus10001397 62 / 3e-13 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10026532 60 / 2e-12 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Lus10016129 60 / 6e-12 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1)
Lus10016130 59 / 7e-12 AT2G28085 111 / 2e-32 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G092400 124 / 2e-37 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.006G125100 117 / 8e-35 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.010G226400 60 / 3e-12 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 49 / 5e-08 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 47 / 3e-07 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 45 / 1e-06 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.002G176400 44 / 2e-06 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Potri.005G237000 42 / 1e-05 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.010G253800 42 / 3e-05 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1)
Potri.006G137200 42 / 3e-05 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10030263 pacid=23153037 polypeptide=Lus10030263 locus=Lus10030263.g ID=Lus10030263.BGIv1.0 annot-version=v1.0
ATGTCTAGCAATGACGAAAGCATCCGAGGCTTGATGCTGCTGAAGCTCTTCACAAGGAAGCTGCAAAGGACACTGATGATGATGACATCCAGAGGAGGAG
GAGGAGGAGGAGGAGGAGGAGGGCACAACCTGCAGAAAAGAAGTGGAGAGTTTGAAGAAGATGAACAGGGAATGAAAGTTGTACCAGGTGATGTGAAGAG
AGGGCAGTTTGCAGTTACAGCAACCAAAGGTGGGAAACCAAAGAGATTCATCGTCGAGTTGGATGACCTGAACGATCCGGATTTCCTCAACTTGCTTGAA
CAGGCTGAGGACAAGTTCGGGTTCCGGCAGGAAGGTGTACTTGAGGTCCCTTGTCACCCTGAGGAGCTTCAGAAGGTTCTAAGAGGAGGCAAGATTAGAA
GAGCAAGTACAGAATGGTGA
AA sequence
>Lus10030263 pacid=23153037 polypeptide=Lus10030263 locus=Lus10030263.g ID=Lus10030263.BGIv1.0 annot-version=v1.0
MSSNDESIRGLMLLKLFTRKLQRTLMMMTSRGGGGGGGGGGHNLQKRSGEFEEDEQGMKVVPGDVKRGQFAVTATKGGKPKRFIVELDDLNDPDFLNLLE
QAEDKFGFRQEGVLEVPCHPEELQKVLRGGKIRRASTEW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09870 SAUR-like auxin-responsive pro... Lus10030263 0 1
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Lus10040083 1.7 0.9693
AT1G14960 Polyketide cyclase/dehydrase a... Lus10042489 2.0 0.9830
AT1G72610 ATGER1, GLP1 A. THALIANA GERMIN-LIKE PROTEI... Lus10002795 2.4 0.9649
AT1G60060 Serine/threonine-protein kinas... Lus10024800 2.6 0.9640
AT2G02950 PKS1 phytochrome kinase substrate 1... Lus10030480 2.8 0.9778
AT1G17930 Aminotransferase-like, plant m... Lus10027047 3.2 0.9571
AT1G13570 F-box/RNI-like superfamily pro... Lus10011048 4.0 0.9661
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10035467 4.4 0.9423
AT5G28010 Polyketide cyclase/dehydrase a... Lus10039891 4.5 0.9661
AT5G25620 YUC6 YUCCA6, Flavin-binding monooxy... Lus10041729 4.7 0.9383

Lus10030263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.