Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60820 82 / 2e-21 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015867 [exp] 90 / 3e-24 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10004024 [exp] 87 / 4e-23 AT3G60820 190 / 4e-61 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10009294 [exp] 69 / 1e-15 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G069800 [exp] 86 / 9e-23 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.002G148300 [exp] 82 / 3e-21 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Lus10030271 pacid=23152972 polypeptide=Lus10030271 locus=Lus10030271.g ID=Lus10030271.BGIv1.0 annot-version=v1.0 ATGTCGATGAATTTTTCTCCCTACGAAAACAATGGCGGGTCTTGCGTTGCGATTGCCGGAGCTGATTATTGTGTGATTGCTTCCGATACTCGGATGTCCA CTGGCTACAATATTCTCACCAGAAACCACTCCAAAGTTTGCAAACTGATCAGAAATGATGATCCAGTAAGTCAACAGTTGCAGTAG
AA sequence Show only first row Show all	>Lus10030271 pacid=23152972 polypeptide=Lus10030271 locus=Lus10030271.g ID=Lus10030271.BGIv1.0 annot-version=v1.0 MSMNFSPYENNGGSCVAIAGADYCVIASDTRMSTGYNILTRNHSKVCKLIRNDDPVSQQLQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60820		PBF1	N-terminal nucleophile aminohy...		Lus10030271 [exp]	0	1
AT4G21480		STP12	sugar transporter protein 12 (...		Lus10012766 [exp]	13.8	0.6272
AT5G66850		MAPKKK5	mitogen-activated protein kina...		Lus10016768 [exp]	20.1	0.6182
AT1G75340	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Lus10040585 [exp]	41.5	0.5871
AT4G14720	ZIM	TIFY4B, PPD2	PEAPOD 2, TIFY domain/Divergen...		Lus10014700 [exp]	43.7	0.5854
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10010801 [exp]	44.7	0.5804
AT5G12970			Calcium-dependent lipid-bindin...		Lus10033343 [exp]	68.6	0.4924
AT3G48810			Pentatricopeptide repeat (PPR)...		Lus10011676 [exp]	69.2	0.5543
AT5G27670		HTA7	histone H2A 7 (.1)		Lus10029899 [exp]	73.8	0.5314
AT1G19110			inter-alpha-trypsin inhibitor ...		Lus10039919 [exp]	142.2	0.5270
AT2G17280			Phosphoglycerate mutase family...		Lus10032820 [exp]	167.4	0.5122

Compare expression of checked genes

Lus10030271 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.