Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60820 81 / 2e-20 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000062 [exp] 93 / 3e-26 AT3G60820 232 / 6e-79 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10015867 [exp] 93 / 2e-25 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10004024 [exp] 86 / 2e-22 AT3G60820 190 / 4e-61 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10009294 [exp] 56 / 1e-10 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G069800 [exp] 82 / 3e-21 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.002G148300 [exp] 82 / 3e-21 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030272 pacid=23153073 polypeptide=Lus10030272 locus=Lus10030272.g ID=Lus10030272.BGIv1.0 annot-version=v1.0 ATGAAAGCTCTACAAAAGCAATTAGCTGCCAGGCACCTGGATGCTGTCACTCCACTTTCGGTATCCGAAGCGATCGATTTGGTGAAAACCTGTTTCGCTT CTGCAACCGAGAGGGACATATACACCGGTGACAAGCTTGAAATAGTCGTGCTAAATGCTGACGGTATTCGTTGTGAATTTATGAATATGAAGTTAGACTA G
AA sequence Show only first row Show all	>Lus10030272 pacid=23153073 polypeptide=Lus10030272 locus=Lus10030272.g ID=Lus10030272.BGIv1.0 annot-version=v1.0 MKALQKQLAARHLDAVTPLSVSEAIDLVKTCFASATERDIYTGDKLEIVVLNADGIRCEFMNMKLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60820		PBF1	N-terminal nucleophile aminohy...		Lus10030272 [exp]	0	1
					Lus10039776 [exp]	2.4	0.8282
AT3G58190	AS2	LBD29, ASL16	ASYMMETRIC LEAVES 2-LIKE 16, l...		Lus10000613 [exp]	9.6	0.8304
AT1G52790			2-oxoglutarate (2OG) and Fe(II...		Lus10005773 [exp]	21.1	0.7753
AT2G47810	CCAAT	NF-YB5	"nuclear factor Y, subunit B5"...		Lus10008383 [exp]	28.1	0.7338
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10006909 [exp]	29.2	0.7816
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10012478 [exp]	57.4	0.7477
AT5G03840		TFL-1, TFL1	TERMINAL FLOWER 1, PEBP (phosp...		Lus10021372 [exp]	59.9	0.7205
					Lus10014682 [exp]	72.8	0.7309
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10006908 [exp]	75.6	0.7199
AT3G16720		ATL2	TOXICOS EN LEVADURA 2 (.1)		Lus10042277 [exp]	119.1	0.6857

Compare expression of checked genes

Lus10030272 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.