Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45400 77 / 5e-18 BEN1 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G09480 70 / 1e-15 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G09490 70 / 1e-15 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT1G51410 69 / 2e-15 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G66800 69 / 2e-15 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G09510 69 / 2e-15 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G42800 68 / 6e-15 M318, TT3, DFR dihydroflavonol 4-reductase (.1) AT1G76470 67 / 1e-14 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G35420 67 / 1e-14 TKPR1, DRL1 tetraketide alpha-pyrone reductase 1, dihydroflavonol 4-reductase-like1 (.1) AT5G58490 67 / 2e-14 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004029 [exp] 139 / 1e-41 AT2G45400 283 / 7e-94 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10004028 [exp] 89 / 2e-22 AT2G45400 290 / 3e-96 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10030276 [exp] 86 / 4e-22 AT2G45400 158 / 5e-47 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10023096 [exp] 81 / 2e-19 AT5G42800 173 / 1e-50 dihydroflavonol 4-reductase (.1) Lus10032370 [exp] 77 / 4e-18 AT1G61720 171 / 3e-50 BANYULS, NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10032369 [exp] 77 / 4e-18 AT5G42800 141 / 3e-39 dihydroflavonol 4-reductase (.1) Lus10008668 [exp] 76 / 1e-17 AT5G19440 388 / 9e-136 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10026152 [exp] 72 / 1e-16 AT5G19440 291 / 7e-99 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10016389 [exp] 72 / 1e-16 AT1G09480 320 / 1e-109 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G147702 [exp] 83 / 2e-20 AT2G45400 317 / 4e-107 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.002G147800 [exp] 81 / 2e-19 AT2G45400 313 / 2e-105 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.002G147500 [exp] 81 / 2e-19 AT2G45400 311 / 8e-105 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.002G148000 [exp] 79 / 6e-19 AT2G45400 320 / 4e-108 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.006G087200 [exp] 78 / 1e-18 AT2G45400 317 / 6e-107 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.001G093300 [exp] 75 / 2e-17 AT5G42800 199 / 2e-60 dihydroflavonol 4-reductase (.1) Potri.003G138400 [exp] 75 / 2e-17 AT5G42800 202 / 9e-62 dihydroflavonol 4-reductase (.1) Potri.002G147400 [exp] 75 / 2e-17 AT2G45400 344 / 7e-118 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.002G033600 [exp] 74 / 4e-17 AT5G42800 523 / 0.0 dihydroflavonol 4-reductase (.1) Potri.002G147600 [exp] 74 / 5e-17 AT2G45400 345 / 5e-118 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF01370 [flax] [poplar] Epimerase NAD dependent epimerase/dehydratase family
Representative CDS sequence Show only first row Show all	>Lus10030277 pacid=23153093 polypeptide=Lus10030277 locus=Lus10030277.g ID=Lus10030277.BGIv1.0 annot-version=v1.0 ATGGAATCTGAAGAAACAAAAGCTCCGGTTTGCGTCACCGGAGCAACAGGCTTCATAGCTTCATGGCTGATCAAGAAGCTCCTACAACATAACTACCCTG CTCACGCCACCATCCGATCACATAACAACACAGACACTACCACCTTCTTAACAAATCTCCCTGGAGCGTCGATAAATCTCCGCCTCTTCGAGGCGGACTT GTCCCACCCCGACAGTTTCTCCGCCGCCATTCAAGGCTGGGCCGCCACCATCCACGTGGCCACACCTTGA
AA sequence Show only first row Show all	>Lus10030277 pacid=23153093 polypeptide=Lus10030277 locus=Lus10030277.g ID=Lus10030277.BGIv1.0 annot-version=v1.0 MESEETKAPVCVTGATGFIASWLIKKLLQHNYPAHATIRSHNNTDTTTFLTNLPGASINLRLFEADLSHPDSFSAAIQGWAATIHVATP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45400		BEN1	NAD(P)-binding Rossmann-fold s...		Lus10030277 [exp]	0	1

Compare expression of checked genes

Lus10030277 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.