Lus10030292 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G00080 153 / 1e-46 UNE11 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 127 / 2e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G12390 120 / 1e-33 PME1 pectin methylesterase inhibitor 1 (.1)
AT5G62350 116 / 2e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 112 / 1e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 104 / 9e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 97 / 1e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 96 / 5e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G20740 89 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 88 / 2e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001988 370 / 8e-132 AT4G00080 154 / 5e-47 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 121 / 4e-34 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 117 / 7e-33 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 115 / 7e-32 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 114 / 8e-32 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10032230 106 / 3e-28 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10024593 99 / 2e-25 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 84 / 7e-20 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 82 / 3e-19 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G145800 187 / 7e-60 AT4G00080 164 / 4e-51 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G067500 176 / 2e-55 AT4G00080 156 / 1e-47 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 120 / 8e-34 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 119 / 1e-33 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 110 / 7e-30 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.006G137800 99 / 1e-25 AT5G20740 205 / 2e-67 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 97 / 7e-25 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.008G132600 95 / 6e-24 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 94 / 9e-24 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 91 / 1e-22 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10030292 pacid=23153024 polypeptide=Lus10030292 locus=Lus10030292.g ID=Lus10030292.BGIv1.0 annot-version=v1.0
ATGGCGACCACCACCGCCCATTTCCTCCCTCTCCTAATCCTCCTCACCCTCACCGTCTCTGTAAACTCGAACCCCTCGACACCATCCTCGTCTTCCTCGA
ACCCTTACATCGTAAAGCAATGCCAAACCACAAGATACCCGTCCCTCTGCGTCCAGTGCCTCTCCACCTTCGCCAACTCAACCTCCCACCACTCCCCACA
GCAGCTAGCCCGCATCGCCCTCACCGTAAGCCTCTACAAAGCCCGCCTCACCAGATCCTTCCTCCTCAAAGTCAACCGCAACCTCAAGGCGTTGACCAAG
CCACGCCACGACCACTTAGTCATGAACGACTGCCTTGGCCAGCTGGCCGACGGCATCCAGCAGCTCAGCCGGTCCATCCTCGAGCTCGCCCAGCTCGAGA
AGAAAGGCGGAGTCGCGGCAAACGACGACGCTGTTTTGTGGCACGTGAGGAACGTGGAGACCTGGGTGAGCGCTGCCCAGACGGATGCCGACACGTGCTT
GGACGAGTTCCATGGGAAGAAGATGAGTAAGCTTCGGGCTACCATTAAGGTGAGGGTTATGAACGTTGCGGAAACTGCTAGTAATGCTCTGGCTTTGTTT
CAGCGCTTCGTTGTTGCGAGGTTTGGTGCTCGGTTCGCCTCCAAGCGTTATCCGTGA
AA sequence
>Lus10030292 pacid=23153024 polypeptide=Lus10030292 locus=Lus10030292.g ID=Lus10030292.BGIv1.0 annot-version=v1.0
MATTTAHFLPLLILLTLTVSVNSNPSTPSSSSSNPYIVKQCQTTRYPSLCVQCLSTFANSTSHHSPQQLARIALTVSLYKARLTRSFLLKVNRNLKALTK
PRHDHLVMNDCLGQLADGIQQLSRSILELAQLEKKGGVAANDDAVLWHVRNVETWVSAAQTDADTCLDEFHGKKMSKLRATIKVRVMNVAETASNALALF
QRFVVARFGARFASKRYP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G00080 UNE11 unfertilized embryo sac 11, Pl... Lus10030292 0 1
AT2G43870 Pectin lyase-like superfamily ... Lus10002124 1.0 0.9738
AT5G60520 Late embryogenesis abundant (L... Lus10036107 2.4 0.9735
AT2G45570 CYP76C2 "cytochrome P450, family 76, s... Lus10027426 5.5 0.9716
AT1G06330 Heavy metal transport/detoxifi... Lus10020704 6.9 0.9492
AT3G18200 nodulin MtN21 /EamA-like trans... Lus10038959 8.2 0.9684
AT2G02360 ATPP2-B10 phloem protein 2-B10 (.1) Lus10003444 8.3 0.9499
AT1G53130 GRI GRIM REAPER, Stigma-specific S... Lus10005544 8.8 0.9670
AT1G04220 KCS2 3-ketoacyl-CoA synthase 2 (.1) Lus10039399 8.9 0.9676
Lus10025963 9.9 0.9557
AT4G10350 NAC BRN2, NST4, ANA... BEARSKIN 2, NAC domain contain... Lus10013782 12.3 0.9522

Lus10030292 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.