Lus10030295 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G45210 122 / 5e-36 SAUR-like auxin-responsive protein family (.1)
AT3G60690 114 / 2e-32 SAUR-like auxin-responsive protein family (.1)
AT4G22620 94 / 1e-24 SAUR-like auxin-responsive protein family (.1)
AT4G12410 88 / 2e-22 SAUR-like auxin-responsive protein family (.1)
AT2G46690 85 / 1e-21 SAUR-like auxin-responsive protein family (.1)
AT4G00880 82 / 2e-20 SAUR-like auxin-responsive protein family (.1)
AT2G21210 76 / 2e-18 SAUR-like auxin-responsive protein family (.1)
AT3G61900 76 / 3e-18 SAUR-like auxin-responsive protein family (.1)
AT5G53590 75 / 2e-17 SAUR-like auxin-responsive protein family (.1)
AT5G18080 67 / 4e-15 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001985 214 / 4e-72 AT2G45210 93 / 2e-24 SAUR-like auxin-responsive protein family (.1)
Lus10009286 145 / 2e-44 AT3G60690 150 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Lus10015879 132 / 2e-39 AT3G60690 151 / 7e-47 SAUR-like auxin-responsive protein family (.1)
Lus10032237 93 / 3e-24 AT4G12410 149 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Lus10024600 93 / 3e-24 AT4G12410 149 / 3e-46 SAUR-like auxin-responsive protein family (.1)
Lus10004337 87 / 5e-22 AT4G12410 110 / 2e-31 SAUR-like auxin-responsive protein family (.1)
Lus10028920 85 / 7e-22 AT4G12410 106 / 1e-30 SAUR-like auxin-responsive protein family (.1)
Lus10010110 85 / 1e-21 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1)
Lus10034507 71 / 6e-16 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G066900 142 / 2e-43 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1)
Potri.002G145300 136 / 3e-41 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1)
Potri.003G113100 100 / 5e-27 AT4G12410 149 / 1e-46 SAUR-like auxin-responsive protein family (.1)
Potri.001G119900 90 / 3e-23 AT4G12410 140 / 8e-43 SAUR-like auxin-responsive protein family (.1)
Potri.002G176400 84 / 1e-21 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 84 / 2e-21 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 83 / 9e-21 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 80 / 1e-19 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 70 / 5e-16 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.009G127500 66 / 2e-14 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10030295 pacid=23153064 polypeptide=Lus10030295 locus=Lus10030295.g ID=Lus10030295.BGIv1.0 annot-version=v1.0
ATGAGAAAGTTCAGGGGATTTAGATTAGGAAAGGGAATTGTCCGATTAACCAACTGGGTCTTCAGCCAGAGGCGCCGGAGGAACCGATCCCTCTACAACC
GTCTCATTTCCGGCGACGACGGTGTCAGTGACTCCGCAAGGCCGATTACTAACAGGATCAGAAACTGGGGCCTCCGATTAGCCCAATCGATTCGCAACCC
GAGCCGCAGGTTCGGTTCTGGGTACGAACCGGTTCCGGTTCCGAAGGGTCAACTGGCGGTGTACGTCGGTCAAAAGGGTGACGGCAGCGGCGATGTGTGT
CGTAGGGTGTTGGTTCCGGTGATATACATTAATCATCCTCTGTTCGGCGAGCTTTTGAAGGGAGCACAGGAAGAGTACGGTTTCGATCAGAAAGGTGGTA
TCACGATTCCTTGCCCGTTCCGGGAGTTTGAGCGGGTGAAGACCCGGATTGATGCTGGCTCCGCCGGCAGTTCTACCCGGCGGCGGTGA
AA sequence
>Lus10030295 pacid=23153064 polypeptide=Lus10030295 locus=Lus10030295.g ID=Lus10030295.BGIv1.0 annot-version=v1.0
MRKFRGFRLGKGIVRLTNWVFSQRRRRNRSLYNRLISGDDGVSDSARPITNRIRNWGLRLAQSIRNPSRRFGSGYEPVPVPKGQLAVYVGQKGDGSGDVC
RRVLVPVIYINHPLFGELLKGAQEEYGFDQKGGITIPCPFREFERVKTRIDAGSAGSSTRRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G45210 SAUR-like auxin-responsive pro... Lus10030295 0 1
AT4G04955 ATALN allantoinase (.1) Lus10025648 12.0 0.6545
AT4G05000 VPS28-2, VPS28-... vacuolar protein sorting-assoc... Lus10011243 23.2 0.6483
AT5G64550 loricrin-related (.1) Lus10019307 26.4 0.6518
AT1G07350 SR45a serine/arginine rich-like prot... Lus10040705 51.3 0.5807
AT3G01910 AT-SO, ATSO, SO... sulfite oxidase (.1.2.3) Lus10041560 64.0 0.6074
AT1G30800 Fasciclin-like arabinogalactan... Lus10023390 72.1 0.5526
AT3G23000 PKS7, ATSRPK1, ... SNF1-RELATED PROTEIN KINASE 3.... Lus10021892 139.5 0.5453
AT3G23160 Protein of unknown function (D... Lus10021210 205.1 0.5249

Lus10030295 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.