Plant FIBer expression Database

Lus10030298 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13510 184 / 3e-60 EMB3136 EMBRYO DEFECTIVE 3136, Ribosomal protein L10 family protein (.1)
AT3G12370 118 / 6e-35 Ribosomal protein L10 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001982
[exp]
228 / 8e-78 AT5G13510 307 / 4e-107 EMBRYO DEFECTIVE 3136, Ribosomal protein L10 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G215900
[exp]
185 / 8e-61 AT5G13510 300 / 4e-104 EMBRYO DEFECTIVE 3136, Ribosomal protein L10 family protein (.1)
Potri.008G045800
[exp]
184 / 2e-60 AT5G13510 273 / 2e-93 EMBRYO DEFECTIVE 3136, Ribosomal protein L10 family protein (.1)
PFAM info
Representative CDS sequence
>Lus10030298 pacid=23153149 polypeptide=Lus10030298 locus=Lus10030298.g ID=Lus10030298.BGIv1.0 annot-version=v1.0
ATGACTGGCATGAATGCTTGGCTCTTTGTACACTCGGAAGAGATTCCCGAGGCCATTAAGCCTTACAGGAGTTTCCAGAAGGAGAATAAGTTGGAGGAAA
ATGATTTCGGGGGTGCTGTTTTCGAAGGCAAGTTTTATGCACCTGATGAGTTCAAGCAGCTGGAGACAATGCCGTCAAGGGCCGAGATCTATGCTAAGCT
CTTGGGTTCATTGCAGACCCCGGCTATTGGCTTGGTCACAACATTGCAGGCCCCTGCTAGGGATGTGGTTATGGTTCTCAAGGCTTATGTCAAGAAATTG
GAGGATGAGCAAGCTGCTGATGGCCAATAG
AA sequence
>Lus10030298 pacid=23153149 polypeptide=Lus10030298 locus=Lus10030298.g ID=Lus10030298.BGIv1.0 annot-version=v1.0
MTGMNAWLFVHSEEIPEAIKPYRSFQKENKLEENDFGGAVFEGKFYAPDEFKQLETMPSRAEIYAKLLGSLQTPAIGLVTTLQAPARDVVMVLKAYVKKL
EDEQAADGQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G13510 EMB3136 EMBRYO DEFECTIVE 3136, Ribosom... Lus10030298
[exp]
0 1
AT3G54210 Ribosomal protein L17 family p... Lus10000382
[exp]
1.0 0.9611
AT3G08740 elongation factor P (EF-P) fam... Lus10022740
[exp]
2.8 0.9518
AT2G35410 RNA-binding (RRM/RBD/RNP motif... Lus10035678
[exp]
3.5 0.9440
AT5G13510 EMB3136 EMBRYO DEFECTIVE 3136, Ribosom... Lus10001982
[exp]
6.6 0.9314
AT3G19810 Protein of unknown function (D... Lus10010214
[exp]
6.7 0.9390
AT5G06290 2CPB, 2-CysPrxB... 2-CYS PEROXIREDOXIN B, 2-cyste... Lus10016969
[exp]
7.2 0.9428
AT5G46580 pentatricopeptide (PPR) repeat... Lus10000897
[exp]
7.9 0.9330
AT4G17600 LIL3:1 Chlorophyll A-B binding family... Lus10000959
[exp]
8.5 0.9343
AT3G25920 RPL15 ribosomal protein L15 (.1) Lus10010916
[exp]
12.0 0.9335
AT1G67280 Glyoxalase/Bleomycin resistanc... Lus10038612
[exp]
13.0 0.9251

Lus10030298 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.