Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09500 184 / 2e-61 Ribosomal L29 family protein (.1) AT5G02610 183 / 3e-61 Ribosomal L29 family protein (.1.2) AT2G39390 182 / 1e-60 Ribosomal L29 family protein (.1) AT3G55170 177 / 6e-59 Ribosomal L29 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003306 [exp] 206 / 3e-70 AT3G09500 218 / 6e-75 Ribosomal L29 family protein (.1) Lus10019179 [exp] 198 / 6e-67 AT5G02610 210 / 7e-72 Ribosomal L29 family protein (.1.2) Lus10023449 [exp] 195 / 2e-65 AT5G02610 209 / 5e-71 Ribosomal L29 family protein (.1.2) Lus10025292 [exp] 187 / 6e-63 AT5G02610 221 / 5e-76 Ribosomal L29 family protein (.1.2) Lus10024437 [exp] 179 / 1e-59 AT5G02610 218 / 6e-75 Ribosomal L29 family protein (.1.2) Lus10019180 [exp] 154 / 1e-49 AT5G02610 172 / 4e-57 Ribosomal L29 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G212300 [exp] 194 / 2e-65 AT2G39390 213 / 4e-73 Ribosomal L29 family protein (.1) Potri.006G214200 [exp] 189 / 3e-63 AT2G39390 186 / 3e-62 Ribosomal L29 family protein (.1) Potri.008G048800 [exp] 187 / 9e-63 AT5G02610 177 / 1e-58 Ribosomal L29 family protein (.1.2) Potri.006G214100 [exp] 184 / 2e-61 AT2G39390 189 / 2e-63 Ribosomal L29 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0346 [flax] [poplar] Ribo_L29 PF00831 [flax] [poplar] Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence Show only first row Show all	>Lus10030314 pacid=23152998 polypeptide=Lus10030314 locus=Lus10030314.g ID=Lus10030314.BGIv1.0 annot-version=v1.0 ATGGCCAGAATCAAGGTCCACGAGCTGAGGCAGAAGAACAAGTCGGACCTTTTGAACCAGTTGAAGGATCTCAAGGCTGAGCTCGCCCTCCTCCGCGTCG CTAAGGTCACTGGAGGCGCTCCTAACAAACTCTCCAAGATTAAGGTGGTGCGCTTGTCCATTGCCCAAGTCTTGACTGTGATTTCACAGAAGCAGAAAGC TGCTTTACGAGAAGTCTACAAGCACAAGAAGCTCTTGCCTCTTGATCTTCGTCCTAAGAAGACTAGAGCCATTAGAAGAAGGCTTACAAAGCACCAGCAA TCATTGAAGACGGAGAGGGAGCAGAAGAGAGAAATGTACTTCCCAATGAGAAAGTATGCAATCAAGGTTTAA
AA sequence Show only first row Show all	>Lus10030314 pacid=23152998 polypeptide=Lus10030314 locus=Lus10030314.g ID=Lus10030314.BGIv1.0 annot-version=v1.0 MARIKVHELRQKNKSDLLNQLKDLKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAALREVYKHKKLLPLDLRPKKTRAIRRRLTKHQQ SLKTEREQKREMYFPMRKYAIKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09500			Ribosomal L29 family protein ...		Lus10030314 [exp]	0	1
AT2G19480		NFA2, NFA02, NA...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10011959 [exp]	2.6	0.7072
AT1G31500			DNAse I-like superfamily prote...		Lus10000006 [exp]	13.0	0.6944
AT1G22950			2-oxoglutarate (2OG) and Fe(II...		Lus10000171 [exp]	19.7	0.6680
AT1G03910			unknown protein		Lus10030000 [exp]	21.2	0.6874
AT1G66140	C2H2ZnF	ZFP4	zinc finger protein 4 (.1)		Lus10013243 [exp]	29.8	0.6436
AT5G49060			Heat shock protein DnaJ, N-ter...		Lus10037502 [exp]	30.0	0.6554
AT4G34180			Cyclase family protein (.1)		Lus10031454 [exp]	31.4	0.6562
AT5G48580		FKBP15-2	FK506- and rapamycin-binding p...		Lus10035800 [exp]	31.7	0.6707
AT1G31830			Amino acid permease family pro...		Lus10003232 [exp]	37.6	0.6410
AT2G39445			Phosphatidylinositol N-acetylg...		Lus10003796 [exp]	41.0	0.5870

Compare expression of checked genes

Lus10030314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.