Lus10030318 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G55230 212 / 5e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G39430 200 / 3e-63 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G07730 135 / 2e-37 Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT2G28670 122 / 5e-34 ESB1 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT4G13580 94 / 4e-23 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G24020 93 / 1e-22 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G28671 45 / 1e-05 unknown protein
AT5G42500 41 / 0.0003 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003301 299 / 1e-98 AT3G55230 254 / 2e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10006317 124 / 5e-34 AT2G28670 271 / 1e-89 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Lus10029585 99 / 4e-26 AT2G28670 166 / 6e-53 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Lus10023689 97 / 4e-24 AT3G24020 336 / 1e-117 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10011767 97 / 4e-24 AT3G24020 339 / 7e-119 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 47 / 4e-06 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10016231 44 / 3e-05 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 44 / 3e-05 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 43 / 9e-05 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G049100 223 / 4e-71 AT2G39430 251 / 6e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.010G211900 219 / 6e-70 AT2G39430 249 / 3e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.010G211800 138 / 2e-39 AT2G28670 257 / 6e-83 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.008G049200 134 / 1e-37 AT2G28670 276 / 2e-90 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G174300 95 / 3e-23 AT3G24020 315 / 2e-109 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G054100 95 / 5e-23 AT4G13580 308 / 3e-106 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G054000 82 / 2e-18 AT3G24020 352 / 5e-124 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.010G212000 64 / 7e-12 AT1G07730 103 / 1e-25 Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216400 47 / 2e-06 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 46 / 6e-06 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10030318 pacid=23153072 polypeptide=Lus10030318 locus=Lus10030318.g ID=Lus10030318.BGIv1.0 annot-version=v1.0
ATGCACGACATCCTAGGAGGATCCCGGCCGTCAGCGAGAGTGGTAGCCGGAATAATCGCGAGGACGGACATCAACGGGATCCCATTCTCGGTCCCGAACA
ACAACATCTTCCCACTCCAAGGGGGAACCCCGCTGCTGAATCCTAACAACATCAACAACTTAATAAACCCGAACACCGCCCCCTTAATGACCGGGCTCAA
TCCTAGCGCCACGTCCGGGCAAGCAAACACCGTCCTCCAGAACGCAGGAAGCAGCGGCGTGGTGAACCCGCCCTCCAACAGCCAGCCGTTCGTTACGGCA
GGGCGGGCGGGGGGGGGGGCGGCAGGGCAGCTGCCGGCGGGGCTGACACTGCAGAAGCTGATGTTCGGGTCGATCACGGTGTTCGATGACGAATTAACGG
AAGGGCATGAGTTGGGTTCGGCGGTGCTAGGGAGAGCTCAAGGGTTTTACCTCGCGAGCTCGGTGGACGGGACCAGCCACACGATGTCGATGACTCTGAT
GATGCACGAGCACGGTGGTGAGCATGAGCACGAGGGTCATGAAGACACAATCAGCTTCTTTGGGGTTCACAGGAATGCGGCGCCGGTATCGAGTGTGGCG
GTGGTTGGCGGGACAGGAAAGTATGAGGATGCTAAAGGGTATGCGACGATAGAGGCGATTCATCAGGAGGATCAGCATGTCACTGATGGTGTTGATACTA
TTACCCATATCAATGTGTATCTTTCCTACTGA
AA sequence
>Lus10030318 pacid=23153072 polypeptide=Lus10030318 locus=Lus10030318.g ID=Lus10030318.BGIv1.0 annot-version=v1.0
MHDILGGSRPSARVVAGIIARTDINGIPFSVPNNNIFPLQGGTPLLNPNNINNLINPNTAPLMTGLNPSATSGQANTVLQNAGSSGVVNPPSNSQPFVTA
GRAGGGAAGQLPAGLTLQKLMFGSITVFDDELTEGHELGSAVLGRAQGFYLASSVDGTSHTMSMTLMMHEHGGEHEHEGHEDTISFFGVHRNAAPVSSVA
VVGGTGKYEDAKGYATIEAIHQEDQHVTDGVDTITHINVYLSY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G55230 Disease resistance-responsive ... Lus10030318 0 1
AT2G28670 ESB1 ENHANCED SUBERIN 1, Disease re... Lus10029585 1.4 0.9840
AT2G28670 ESB1 ENHANCED SUBERIN 1, Disease re... Lus10006317 2.0 0.9811
AT5G56040 Leucine-rich receptor-like pro... Lus10018094 3.5 0.9541
AT3G15730 PLDALPHA1 phospholipase D alpha 1 (.1) Lus10018575 3.5 0.9687
AT5G19200 TSC10B TSC10B, NAD(P)-binding Rossman... Lus10010510 4.2 0.9526
AT3G06060 TSC10A TSC10A, NAD(P)-binding Rossman... Lus10010509 4.9 0.9535
AT2G45430 AT-hook AHL22 AT-hook motif nuclear-localize... Lus10006664 5.0 0.9645
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Lus10041055 5.9 0.9535
AT5G62620 Galactosyltransferase family p... Lus10004256 6.0 0.9494
AT3G15730 PLDALPHA1 phospholipase D alpha 1 (.1) Lus10039806 6.6 0.9685

Lus10030318 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.