Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030329 pacid=23153002 polypeptide=Lus10030329 locus=Lus10030329.g ID=Lus10030329.BGIv1.0 annot-version=v1.0 ATGGAAGCAAGGCAATTCCTCAAGGACAAGAGATTCTGGTTCGCTTCTGCCCTAATAGCCTGGGCTGCCGCTCTTCAGCCAGAAGGGGTGCTGGCTGCAA CTGCAAGTATTCTAGAAGACCATGCGGCCAAGATTGCGTGCCGAGTCTCTATTCCGATCATAAGATTCCCCAGAGATTCATCATCAGTCCACAAGGTTTT GGTGCCAGCCGCAGCGTCACCAGACAATTACAGATCTGCAGATACACAGTGA
AA sequence Show only first row Show all	>Lus10030329 pacid=23153002 polypeptide=Lus10030329 locus=Lus10030329.g ID=Lus10030329.BGIv1.0 annot-version=v1.0 MEARQFLKDKRFWFASALIAWAAALQPEGVLAATASILEDHAAKIACRVSIPIIRFPRDSSSVHKVLVPAAASPDNYRSADTQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030329 [exp]	0	1
AT2G30620			winged-helix DNA-binding trans...		Lus10022001 [exp]	6.3	0.8039
AT1G76010			Alba DNA/RNA-binding protein (...		Lus10005615 [exp]	21.9	0.7892
AT3G55000		TON1A	TONNEAU 1A, TONNEAU 1, tonneau...		Lus10001983 [exp]	25.3	0.7544
AT1G09815		POLD4	polymerase delta 4 (.1)		Lus10020362 [exp]	27.0	0.7470
AT5G06920		FLA21	FASCICLIN-like arabinogalactan...		Lus10039717 [exp]	29.7	0.6895
AT1G65650		UCH2	Peptidase C12, ubiquitin carbo...		Lus10042047 [exp]	33.8	0.7352
AT3G54560		HTA11	histone H2A 11 (.1)		Lus10003088 [exp]	41.4	0.7282
AT2G14820		MEL3, NPY2	NAKED PINS IN YUC MUTANTS 2, M...		Lus10014632 [exp]	44.1	0.7324
AT1G80100		AHP6	histidine phosphotransfer prot...		Lus10011487 [exp]	48.4	0.6940
AT5G03500			Mediator complex, subunit Med7...		Lus10029326 [exp]	56.0	0.7006

Compare expression of checked genes

Lus10030329 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.