Plant FIBer expression Database

Lus10030338 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G32960 40 / 0.0001 ATSBT3.3 Subtilase family protein (.1)
AT4G00230 39 / 0.0004 XSP1 xylem serine peptidase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034544
[exp]
40 / 0.0002 AT1G20160 846 / 0.0 Subtilisin-like serine endopeptidase family protein (.1.2)
Lus10023048
[exp]
38 / 0.0008 AT5G59810 762 / 0.0 Subtilase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G450600
[exp]
40 / 9e-05 AT1G32960 772 / 0.0 Subtilase family protein (.1)
Potri.011G150900
[exp]
39 / 0.0003 AT1G32960 744 / 0.0 Subtilase family protein (.1)
Potri.002G018600
[exp]
38 / 0.0007 AT1G20160 889 / 0.0 Subtilisin-like serine endopeptidase family protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10030338 pacid=23152975 polypeptide=Lus10030338 locus=Lus10030338.g ID=Lus10030338.BGIv1.0 annot-version=v1.0
ATGATCGCCTCATCAAAAGGGTGGAGAGCTATAGGGTCGACGTGGAGGGGATATCTCGGAGGAGTATTCGGGGTGGCAATGCCTGGTTTTGATACAGGAA
GTCGACAGGACTGTGAAGGTGGAGGTGGAAGGGAGCCGACGACGGCGATGGAATTAATCGGCGAATCTCCAGACTGTAAAGAAACCAAGAACAACCGCCG
ACTCTCGACCCATCTTCCCACCACCGACCACAACCTAATATGGGGCTTCTCATGCCCAAGAAAGGGTATCACGGTGATTTGCTCCGCCGGGAACGACGAC
CCTAAGTCGGAAACAGTTGTCAACTATGAACCCTAG
AA sequence
>Lus10030338 pacid=23152975 polypeptide=Lus10030338 locus=Lus10030338.g ID=Lus10030338.BGIv1.0 annot-version=v1.0
MIASSKGWRAIGSTWRGYLGGVFGVAMPGFDTGSRQDCEGGGGREPTTAMELIGESPDCKETKNNRRLSTHLPTTDHNLIWGFSCPRKGITVICSAGNDD
PKSETVVNYEP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10030338
[exp]
0 1
AT2G36540 Haloacid dehalogenase-like hyd... Lus10016365
[exp]
6.5 0.7140
Lus10041373
[exp]
11.0 0.6853
AT1G62300 WRKY ATWRKY6, WRKY6 WRKY family transcription fact... Lus10022959
[exp]
12.4 0.6695
AT5G63380 AMP-dependent synthetase and l... Lus10041584
[exp]
21.8 0.6819
AT2G18460 LCV3 like COV 3 (.1) Lus10026023
[exp]
23.7 0.6212
AT3G03550 RING/U-box superfamily protein... Lus10035677
[exp]
24.0 0.6783
AT1G59840 CCB4 cofactor assembly of complex C... Lus10010732
[exp]
26.0 0.6749
AT4G33280 B3 REM16 AP2/B3-like transcriptional fa... Lus10016286
[exp]
26.5 0.5913
AT1G53035 unknown protein Lus10039835
[exp]
26.8 0.6424
AT5G20140 SOUL heme-binding family prote... Lus10040682
[exp]
30.7 0.6225

Lus10030338 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.