Plant FIBer expression Database

Lus10030343 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10100 114 / 1e-34 CNX7, SIR5 "co-factor for nitrate, reductase and xanthine dehydrogenase 7", co-factor for nitrate, reductase and xanthine dehydrogenase 7 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041075
[exp]
186 / 1e-62 AT4G10100 120 / 5e-37 "co-factor for nitrate, reductase and xanthine dehydrogenase 7", co-factor for nitrate, reductase and xanthine dehydrogenase 7 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G070801
[exp]
129 / 3e-40 AT4G10100 122 / 1e-37 "co-factor for nitrate, reductase and xanthine dehydrogenase 7", co-factor for nitrate, reductase and xanthine dehydrogenase 7 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF02597 ThiS ThiS family
Representative CDS sequence
>Lus10030343 pacid=23153190 polypeptide=Lus10030343 locus=Lus10030343.g ID=Lus10030343.BGIv1.0 annot-version=v1.0
ATGGCTGCTGTGGACATGAAGATGGAGAATGTTGGTGTTAAACCAGTTGTTGGCAAGGCATCGGCATCGGCATCCTCCTCGGCACTTAAGATAAAGGTGT
TGTTCTTTGCTAGAGCTCGAGATCTAACCGGGGCGAATGAAACGCTGCTTGAGGTTTCATCGGGCAGCACAGCAGGTGAGTGCTTGAATGAGCTCATTGT
TCGGTTTCCAGGGTTGGAGGATATCCGTAGATGTATGGTACTAGCACTTAACGAGGAATACTCATCGGAGTCTGCAATTGTCAAGGAGAAGGACGAGCTG
GCAATCATTCCCCCCATCAGTGGTGGCTAG
AA sequence
>Lus10030343 pacid=23153190 polypeptide=Lus10030343 locus=Lus10030343.g ID=Lus10030343.BGIv1.0 annot-version=v1.0
MAAVDMKMENVGVKPVVGKASASASSSALKIKVLFFARARDLTGANETLLEVSSGSTAGECLNELIVRFPGLEDIRRCMVLALNEEYSSESAIVKEKDEL
AIIPPISGG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10100 CNX7, SIR5 "co-factor for nitrate, reduct... Lus10030343
[exp]
0 1
AT1G11780 oxidoreductase, 2OG-Fe(II) oxy... Lus10015782
[exp]
2.8 0.9081
AT4G14465 AT-hook AHL20 AT-hook motif nuclear-localize... Lus10002711
[exp]
4.5 0.8884
AT5G27400 S-adenosyl-L-methionine-depend... Lus10015166
[exp]
5.7 0.9100
AT5G59613 unknown protein Lus10005899
[exp]
6.6 0.9167
AT3G56210 ARM repeat superfamily protein... Lus10010218
[exp]
8.5 0.8905
AT3G22660 rRNA processing protein-relate... Lus10037050
[exp]
10.2 0.8968
AT4G33740 unknown protein Lus10020507
[exp]
10.3 0.9132
AT4G08690 Sec14p-like phosphatidylinosit... Lus10033464
[exp]
10.4 0.8979
AT1G11340 S-locus lectin protein kinase ... Lus10018406
[exp]
11.0 0.9078
AT3G52230 unknown protein Lus10028838
[exp]
13.0 0.8989

Lus10030343 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.