Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41010 87 / 6e-25 NRPE12, NRPD12, NRPB12 DNA directed RNA polymerase, 7 kDa subunit (.1) AT1G53690 63 / 3e-15 DNA directed RNA polymerase, 7 kDa subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007891 [exp] 104 / 6e-32 AT5G41010 86 / 1e-24 DNA directed RNA polymerase, 7 kDa subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G144800 [exp] 90 / 3e-26 AT5G41010 99 / 9e-30 DNA directed RNA polymerase, 7 kDa subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF03604 [flax] [poplar] DNA_RNApol_7kD DNA directed RNA polymerase, 7 kDa subunit
Representative CDS sequence Show only first row Show all	>Lus10030353 pacid=23152999 polypeptide=Lus10030353 locus=Lus10030353.g ID=Lus10030353.BGIv1.0 annot-version=v1.0 ATGGATCCTCTGCCAGAGCCGGTCAGCTACATCTGCGGAGATTGTGGAACAGAGAATACTCTGAAGCCTGGCGATGTCATCCAGTGCCGAGAGTGCGGTT ACCGTATCCTCTACAAGAAGCGCACCCGCCGAAGTACTCTCCTTTTCCCCTCTCTAAATCGTTTGGTTGAGTCCTAG
AA sequence Show only first row Show all	>Lus10030353 pacid=23152999 polypeptide=Lus10030353 locus=Lus10030353.g ID=Lus10030353.BGIv1.0 annot-version=v1.0 MDPLPEPVSYICGDCGTENTLKPGDVIQCRECGYRILYKKRTRRSTLLFPSLNRLVES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10030353 [exp]	0	1
AT3G58480			calmodulin-binding family prot...		Lus10016219 [exp]	1.0	0.8487
AT4G26590		ATOPT5	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10014885 [exp]	2.4	0.8360
					Lus10000657 [exp]	2.8	0.8323
					Lus10014667 [exp]	3.9	0.8152
AT4G14110		FUS7, EMB143, C...	FUSCA 7, EMBRYO DEFECTIVE 143,...		Lus10005729 [exp]	5.5	0.8393
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10033547 [exp]	8.5	0.8092
AT2G40390			unknown protein		Lus10017423 [exp]	8.9	0.7877
AT5G02260		ATHEXPALPHA1.10...	expansin A9 (.1)		Lus10033801 [exp]	11.5	0.7753
AT1G54250		NRPE8A, NRPB8A,...	RNA polymerase Rpb8 (.1)		Lus10013760 [exp]	15.0	0.7828
AT3G01435			Expressed protein (.1)		Lus10003331 [exp]	16.1	0.7855

Compare expression of checked genes

Lus10030353 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.