Lus10030354 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 159 / 4e-49 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 118 / 7e-33 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 98 / 7e-25 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 76 / 1e-16 ATDR4 drought-repressed 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007902 415 / 3e-149 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007892 411 / 7e-148 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007890 410 / 1e-147 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007889 390 / 1e-139 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013770 382 / 2e-136 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039163 380 / 1e-135 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030355 254 / 1e-85 AT1G17860 149 / 5e-45 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 243 / 1e-81 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 241 / 3e-81 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 211 / 5e-69 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 210 / 7e-69 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 205 / 7e-67 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 187 / 2e-59 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 181 / 2e-57 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 175 / 3e-55 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 145 / 2e-43 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 87 / 4e-21 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 87 / 5e-21 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.007G111800 85 / 3e-20 AT1G73260 79 / 3e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10030354 pacid=23153208 polypeptide=Lus10030354 locus=Lus10030354.g ID=Lus10030354.BGIv1.0 annot-version=v1.0
ATGATGATCATGAACACCACAGCAGCAGCAACAGCAAATGCAATGCTGGTAATGGCCTTATTCGCCATCACTCTCTCTTCCACCTTCGCCGCTAGATCTC
TCGCCGAAACCCTTGCCACTTCATCCCTAACCCCACTTCCCGTTCTCGATGTGGACGGGAAAGTGGTCAGGTCAGGGACCACTTACTACGCAATCCCTGC
AACTAGTGGTGAAGGTGGTGGTGTTGCATTAGCTAGCATGACCAAGGACCCTGAGAGCTGCCCGCAGACTGTAGTCCAAGATGAGGACGAGATTTCCCAA
GGTCTCGCTCTGACATTCGCCCCGGTCAACACCAAGTCGGGTTACACCGTTCGCACGTTCACGGACCTCAATATCAAGTTCTCTGCTGACACAACCTGTG
AAGAAGGAACGGCGTGGAAGGTTGATGACTACAATGATGACGTCGAGCAGTGGTTCATAGGGAGTGGCGGGGTTGAAGGGAACCCTGGTCCGAGAACTGT
GAAGAATTGGTTCAAAATTTGGAAATATGGTTCGAACTATAAGTTTTCGTACTGTCCTGCAGTATGCAAATCGTGCAAAGTTGATTGCAAGGATGTCGGA
ATTTATGTGGATGAGAATGGAGGGAGGAGGTTGGCTTTGGTTGACAAGGAAGCTGACCCTTTCGTAGTTAGGTTCGTCAAGGCAACTTGA
AA sequence
>Lus10030354 pacid=23153208 polypeptide=Lus10030354 locus=Lus10030354.g ID=Lus10030354.BGIv1.0 annot-version=v1.0
MMIMNTTAAATANAMLVMALFAITLSSTFAARSLAETLATSSLTPLPVLDVDGKVVRSGTTYYAIPATSGEGGGVALASMTKDPESCPQTVVQDEDEISQ
GLALTFAPVNTKSGYTVRTFTDLNIKFSADTTCEEGTAWKVDDYNDDVEQWFIGSGGVEGNPGPRTVKNWFKIWKYGSNYKFSYCPAVCKSCKVDCKDVG
IYVDENGGRRLALVDKEADPFVVRFVKAT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10030354 0 1
AT2G27410 B3 Domain of unknown function (DU... Lus10027286 1.0 0.9729
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Lus10008614 4.5 0.9398
AT5G13530 KEG KEEP ON GOING, protein kinases... Lus10020272 5.3 0.9255
AT1G03495 HXXXD-type acyl-transferase fa... Lus10029826 6.8 0.9136
AT3G15980 Coatomer, beta' subunit (.1.2.... Lus10026094 7.1 0.9524
AT2G19070 SHT spermidine hydroxycinnamoyl tr... Lus10005358 8.8 0.9532
Lus10030774 9.8 0.9377
AT3G15980 Coatomer, beta' subunit (.1.2.... Lus10002324 10.6 0.9343
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10019728 12.6 0.8930
AT1G31720 Protein of unknown function (D... Lus10034746 12.6 0.9060

Lus10030354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.