Lus10030355 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 148 / 1e-44 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73325 110 / 2e-29 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 109 / 3e-29 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73330 87 / 1e-20 ATDR4 drought-repressed 4 (.1)
AT1G72290 51 / 1e-07 Kunitz family trypsin and protease inhibitor protein (.1)
AT3G04330 41 / 0.0002 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007888 320 / 8e-113 AT1G17860 125 / 7e-37 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039163 271 / 3e-92 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013770 267 / 5e-91 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007889 262 / 4e-89 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007890 256 / 2e-86 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007892 254 / 7e-86 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030354 254 / 8e-86 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007902 253 / 3e-85 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 242 / 2e-81 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 198 / 4e-64 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 197 / 1e-63 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 192 / 6e-62 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 170 / 6e-53 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 169 / 1e-52 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 162 / 3e-50 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 127 / 2e-36 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 81 / 9e-19 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 77 / 4e-17 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.007G111800 77 / 4e-17 AT1G73260 79 / 3e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10030355 pacid=23153182 polypeptide=Lus10030355 locus=Lus10030355.g ID=Lus10030355.BGIv1.0 annot-version=v1.0
ATGGCGGCTCAAGCATCAGTTATGCTTCCACCATTAATACTACTACTACTAACTCCCCTGTTTCTGTCCGCTGCCTTAACCGATCCGGCGGCGGCGGAAC
CAAAGTACAACACGGAGGCCGCCGTGGCAGCTGGACCGCCTGTCCCCATCCTAGACATAGACGGAAAAGCCGTCCGAGCAGGCAGCAGCTACTACATCAT
ACCCGCCACGTCACCAGCCACCGATTTCGGCGGAGTCAGAATGGCCAGCTCAACAAACGACTCCAACACTTGTCCACTCTCTGTCATCCAGGATCCCCAC
GAGGACTCGAGTGGGACCCCGCTGATGTTCCTCCCCGTGGCGACCAAAGTAGGGTACATGGTCCGCACGTCTACCGACCTTAACATAGAGTTCACGGCAG
ACGACACGGCCACCTGCGACGAGGGCAACGTGTGGAAGGTGGACGACTACGATGACGACGTGGAGCAGTGGTTCGTGGGGACCGGTGGGGTGGAAGGGAA
GCCCGGTCCGAGGACGATCAACAACTGGTTCAAGATCGTGAAATATGGAGGGAGCTACAAGGTGGCGTACTGTCCAGGAGTTTGTAAATCGTGTAAGATT
AAGTGTAAGGATGTAGGGTTGTTTGTTGATGAGAATGGGACCAGGAGGCTTGCTCTTACTGAAGACCACCCTTTTGTTGTCAGCTTCATGAAGGCTGATT
AA
AA sequence
>Lus10030355 pacid=23153182 polypeptide=Lus10030355 locus=Lus10030355.g ID=Lus10030355.BGIv1.0 annot-version=v1.0
MAAQASVMLPPLILLLLTPLFLSAALTDPAAAEPKYNTEAAVAAGPPVPILDIDGKAVRAGSSYYIIPATSPATDFGGVRMASSTNDSNTCPLSVIQDPH
EDSSGTPLMFLPVATKVGYMVRTSTDLNIEFTADDTATCDEGNVWKVDDYDDDVEQWFVGTGGVEGKPGPRTINNWFKIVKYGGSYKVAYCPGVCKSCKI
KCKDVGLFVDENGTRRLALTEDHPFVVSFMKAD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10030355 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10007888 3.2 0.9472
AT1G17860 Kunitz family trypsin and prot... Lus10039210 4.0 0.9728
AT1G49310 unknown protein Lus10040476 4.6 0.9339
AT1G17860 Kunitz family trypsin and prot... Lus10013730 5.1 0.9672
AT1G17860 Kunitz family trypsin and prot... Lus10007890 9.2 0.9576
AT1G17860 Kunitz family trypsin and prot... Lus10022302 10.5 0.9618
AT1G13090 CYP71B28 "cytochrome P450, family 71, s... Lus10002670 11.6 0.9415
AT1G17860 Kunitz family trypsin and prot... Lus10042301 13.6 0.9588
AT1G17860 Kunitz family trypsin and prot... Lus10039209 15.5 0.9398
AT4G37390 AUR3, YDK1, GH3... YADOKARI 1, AUXIN UPREGULATED ... Lus10010391 16.2 0.9502

Lus10030355 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.