Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27830 89 / 3e-22 BGLU10 beta glucosidase 10 (.1) AT1G02850 86 / 4e-21 BGLU11 beta glucosidase 11 (.1.2.3.4.5) AT4G27820 84 / 1e-20 BGLU9 beta glucosidase 9 (.1) AT1G60090 83 / 4e-20 BGLU4 beta glucosidase 4 (.1) AT1G45191 83 / 4e-20 BGLU1 beta glucosidase 1, Glycosyl hydrolase superfamily protein (.1.2) AT3G62750 82 / 1e-19 BGLU8 beta glucosidase 8 (.1) AT4G22100 81 / 2e-19 BGLU3 beta glucosidase 2 (.1) AT1G61810 79 / 1e-18 BGLU45 beta-glucosidase 45 (.1.2.3) AT3G62740 79 / 1e-18 BGLU7 beta glucosidase 7 (.1) AT1G26560 79 / 1e-18 BGLU40 beta glucosidase 40 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007872 [exp] 143 / 7e-42 AT1G02850 621 / 0.0 beta glucosidase 11 (.1.2.3.4.5) Lus10007871 [exp] 131 / 2e-37 AT1G02850 622 / 0.0 beta glucosidase 11 (.1.2.3.4.5) Lus10037099 [exp] 74 / 3e-18 AT1G26560 149 / 6e-44 beta glucosidase 40 (.1) Lus10009013 [exp] 76 / 7e-18 AT3G18080 516 / 0.0 B-S glucosidase 44 (.1) Lus10037098 [exp] 76 / 1e-17 AT1G26560 785 / 0.0 beta glucosidase 40 (.1) Lus10036885 [exp] 76 / 2e-17 AT1G26560 778 / 0.0 beta glucosidase 40 (.1) Lus10009644 [exp] 75 / 3e-17 AT3G18080 812 / 0.0 B-S glucosidase 44 (.1) Lus10004654 [exp] 72 / 2e-16 AT1G26560 773 / 0.0 beta glucosidase 40 (.1) Lus10007655 [exp] 71 / 9e-16 AT1G61820 620 / 0.0 beta glucosidase 46 (.1.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G403900 [exp] 72 / 3e-16 AT4G21760 516 / 7e-180 beta-glucosidase 47 (.1) Potri.010G159900 [exp] 72 / 3e-16 AT1G26560 795 / 0.0 beta glucosidase 40 (.1) Potri.008G094200 [exp] 71 / 7e-16 AT1G26560 798 / 0.0 beta glucosidase 40 (.1) Potri.012G049300 [exp] 71 / 1e-15 AT3G18080 831 / 0.0 B-S glucosidase 44 (.1) Potri.015G041300 [exp] 70 / 2e-15 AT3G18080 839 / 0.0 B-S glucosidase 44 (.1) Potri.003G211100 [exp] 69 / 4e-15 AT5G44640 569 / 0.0 beta glucosidase 13 (.1) Potri.T085301 [exp] 69 / 4e-15 AT5G44640 575 / 0.0 beta glucosidase 13 (.1) Potri.004G019300 [exp] 66 / 4e-14 AT1G61820 636 / 0.0 beta glucosidase 46 (.1.3) Potri.004G019700 [exp] 66 / 4e-14 AT1G61820 655 / 0.0 beta glucosidase 46 (.1.3) Potri.004G019800 [exp] 66 / 5e-14 AT4G21760 658 / 0.0 beta-glucosidase 47 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00232 [flax] [poplar] Glyco_hydro_1 Glycosyl hydrolase family 1
Representative CDS sequence Show only first row Show all	>Lus10030372 pacid=23153035 polypeptide=Lus10030372 locus=Lus10030372.g ID=Lus10030372.BGIv1.0 annot-version=v1.0 ATGTTGATCGTTACGGCTTCATTGCTTCAACATAGAGGTCAACTCAACATGCGCAACACAAGTCTGAAAGACACAAAGAGGGTGCAGTTCTTGCATGCCT ACATGGGTGCTGTATTGGATGCCATTAACGATGGGTGTAACATAAAAGGATACTTCGTTTGGTCGCTGTTGGACGTGTTCGAGTTGTTGGGTGGCTTCAA GACTGGATTCAGACTCTACTACGTTAATTTGGATGATCTGACTCGATATCCTAAACTCTCTACTCATTGA
AA sequence Show only first row Show all	>Lus10030372 pacid=23153035 polypeptide=Lus10030372 locus=Lus10030372.g ID=Lus10030372.BGIv1.0 annot-version=v1.0 MLIVTASLLQHRGQLNMRNTSLKDTKRVQFLHAYMGAVLDAINDGCNIKGYFVWSLLDVFELLGGFKTGFRLYYVNLDDLTRYPKLSTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G45191		BGLU1	beta glucosidase 1, Glycosyl h...		Lus10030372 [exp]	0	1
AT5G26330			Cupredoxin superfamily protein...		Lus10006680 [exp]	4.7	1.0000
AT5G64820			unknown protein		Lus10025572 [exp]	6.5	1.0000
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10037113 [exp]	7.2	1.0000
AT4G36670		AtPMT6, AtPLT6	polyol/monosaccharide transpor...		Lus10017474 [exp]	8.1	1.0000
					Lus10038707 [exp]	10.5	1.0000
AT2G20825	ULT	ULT2	ULTRAPETALA 2, Developmental r...		Lus10038586 [exp]	14.7	1.0000
AT4G18360			Aldolase-type TIM barrel famil...		Lus10038144 [exp]	16.6	1.0000
AT5G12460			Protein of unknown function (D...		Lus10003179 [exp]	16.7	1.0000
					Lus10003763 [exp]	17.6	1.0000
AT1G68570			Major facilitator superfamily ...		Lus10038648 [exp]	17.9	1.0000

Compare expression of checked genes

Lus10030372 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.