Lus10030380 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037861 230 / 1e-78 ND /
Lus10037862 190 / 6e-63 ND /
Lus10028948 129 / 1e-38 ND /
Lus10002152 125 / 4e-37 ND /
Lus10007472 124 / 7e-37 ND 38 / 0.002
Lus10002730 116 / 1e-33 ND /
Lus10014737 115 / 3e-33 ND /
Lus10014735 115 / 3e-33 ND /
Lus10037860 112 / 8e-32 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G158700 114 / 1e-32 ND /
Potri.002G158600 111 / 2e-31 ND /
Potri.014G081800 110 / 4e-31 ND /
Potri.014G082700 110 / 5e-31 ND /
Potri.014G081900 106 / 3e-29 ND /
Potri.017G153100 106 / 3e-29 ND /
Potri.003G126200 105 / 6e-29 ND /
Potri.019G100100 101 / 2e-27 ND /
Potri.014G082000 99 / 1e-26 ND /
Potri.009G009700 98 / 3e-26 ND /
PFAM info
Representative CDS sequence
>Lus10030380 pacid=23153144 polypeptide=Lus10030380 locus=Lus10030380.g ID=Lus10030380.BGIv1.0 annot-version=v1.0
ATGAACATCAACATTAACCTCATGATCATCCTACAAACTCTCTTCCTCCTCCTTCCGATTCCACTTCTCGCAACATCGGCTCAATCCAAACAAACCTCAC
CGAATTCCAACATCACGGTTAGTCTCGCCGAAACCGGTCAAACCCCAGCCATTCTAACCCTCAACGGCTTTGAAAAGGGCGAAGGGGGCGGCGACGCATC
CGAATGTGACAGCAGCTACCACAGCGACGACGAGAACATCGTGGCACTGTCCACTCCGTGGTACAACCAAGGGCAGCGGTGCTCCCAATACATCACGATC
ACTAGGGCCGACGGCGGCCAAGGTACCACGACGGCGAAGGTGGTCGACGAATGTGACGTGTCGGGCGGTTGTCGGGAAAATATTGTGGATGGGTCAAAGG
CTGTTTGGAAAGCCCTTGGTGTGGATGAGAGTGATCCTACTTACGGTGAAATACCGGTTACGTGGGGTATGTGCTAA
AA sequence
>Lus10030380 pacid=23153144 polypeptide=Lus10030380 locus=Lus10030380.g ID=Lus10030380.BGIv1.0 annot-version=v1.0
MNININLMIILQTLFLLLPIPLLATSAQSKQTSPNSNITVSLAETGQTPAILTLNGFEKGEGGGDASECDSSYHSDDENIVALSTPWYNQGQRCSQYITI
TRADGGQGTTTAKVVDECDVSGGCRENIVDGSKAVWKALGVDESDPTYGEIPVTWGMC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10030380 0 1
AT1G65550 Xanthine/uracil permease famil... Lus10036355 1.0 0.9654
AT2G38290 AMT2;1, ATAMT2 AMMONIUM TRANSPORTER 2;1, ammo... Lus10024186 5.0 0.8704
AT3G03200 NAC ANAC045 NAC domain containing protein ... Lus10033650 20.4 0.9135
AT5G11420 Protein of unknown function, D... Lus10025753 29.0 0.8798
AT5G20950 Glycosyl hydrolase family prot... Lus10043457 33.7 0.8792
AT2G03350 Protein of unknown function, D... Lus10036804 42.1 0.8686
AT1G64640 AtENODL8 early nodulin-like protein 8 (... Lus10033227 49.0 0.8624
Lus10037775 149.9 0.8069
AT3G63470 SCPL40 serine carboxypeptidase-like 4... Lus10005327 186.5 0.8063
AT1G08590 Leucine-rich receptor-like pro... Lus10000814 189.1 0.7894

Lus10030380 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.