Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030382 pacid=23153060 polypeptide=Lus10030382 locus=Lus10030382.g ID=Lus10030382.BGIv1.0 annot-version=v1.0 ATGGTAGTCTTTGGAGGGCTCGCTTGGGCCTGCAGTAGCCCGCTTGGTAAAGTTTTCATAAACGACCAACAGGGAGAGAAGGAGGAGAGAGAGAAGGAAC AGAAGAAGCTTCAAGCAAAGAAGAACAAGATGAAAGTTGATGGTAGTGGGAAGAAGAAGAAAGGAAGTGGAGGGTTTCAAGTTGGGAAGAGGAAGTTGAA GATGAAGGCCAAGTTGTCTGCTACTGCAAAAGCTAAAGCTGCTCAAGCCATGGAGCTCGACATGTAG
AA sequence Show only first row Show all	>Lus10030382 pacid=23153060 polypeptide=Lus10030382 locus=Lus10030382.g ID=Lus10030382.BGIv1.0 annot-version=v1.0 MVVFGGLAWACSSPLGKVFINDQQGEKEEREKEQKKLQAKKNKMKVDGSGKKKKGSGGFQVGKRKLKMKAKLSATAKAKAAQAMELDM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030382 [exp]	0	1
AT4G15720			Tetratricopeptide repeat (TPR)...		Lus10006517 [exp]	2.0	0.7767
AT3G03580			Tetratricopeptide repeat (TPR)...		Lus10004744 [exp]	4.9	0.7533
AT5G19151			unknown protein		Lus10034040 [exp]	5.5	0.7453
AT4G38370			Phosphoglycerate mutase family...		Lus10023935 [exp]	6.0	0.7578
AT1G27060			Regulator of chromosome conden...		Lus10036707 [exp]	6.5	0.7377
AT3G32930			unknown protein		Lus10013750 [exp]	9.2	0.6945
AT2G34960		CAT5	cationic amino acid transporte...		Lus10018691 [exp]	11.0	0.7609
AT3G18110		EMB1270	embryo defective 1270, Pentatr...		Lus10013785 [exp]	13.7	0.7258
AT3G15395			unknown protein		Lus10039067 [exp]	13.8	0.7202
AT3G45070			P-loop containing nucleoside t...		Lus10034079 [exp]	15.0	0.7729

Compare expression of checked genes

Lus10030382 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.