Lus10030390 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15570 229 / 5e-71 Phototropic-responsive NPH3 family protein (.1)
AT1G52770 208 / 6e-63 Phototropic-responsive NPH3 family protein (.1)
AT5G64330 135 / 1e-34 JK218, RPT3, NPH3 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
AT5G13600 130 / 4e-33 Phototropic-responsive NPH3 family protein (.1)
AT1G30440 128 / 3e-32 Phototropic-responsive NPH3 family protein (.1)
AT5G03250 127 / 6e-32 Phototropic-responsive NPH3 family protein (.1)
AT4G37590 122 / 2e-30 MEL1, NPY5 NAKED PINS IN YUC MUTANTS 5, MAB4/ENP/NPY1-LIKE 1, Phototropic-responsive NPH3 family protein (.1)
AT1G03010 120 / 1e-29 Phototropic-responsive NPH3 family protein (.1)
AT5G48800 120 / 1e-29 Phototropic-responsive NPH3 family protein (.1)
AT2G23050 117 / 1e-28 MEL4, NPY4 NAKED PINS IN YUC MUTANTS 4, MAB4/ENP/NPY1-LIKE 4, Phototropic-responsive NPH3 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037848 462 / 5e-163 AT3G15570 343 / 1e-115 Phototropic-responsive NPH3 family protein (.1)
Lus10023274 140 / 1e-36 AT1G30440 910 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10038531 139 / 8e-36 AT1G30440 915 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10040409 136 / 7e-35 AT5G03250 667 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10009292 132 / 9e-34 AT5G03250 670 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10013799 132 / 1e-33 AT5G03250 672 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10023523 130 / 7e-33 AT5G03250 667 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10015871 129 / 2e-32 AT5G03250 666 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10026511 126 / 2e-31 AT5G03250 665 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G058800 234 / 6e-73 AT3G15570 499 / 1e-175 Phototropic-responsive NPH3 family protein (.1)
Potri.001G175400 227 / 2e-70 AT1G52770 507 / 8e-179 Phototropic-responsive NPH3 family protein (.1)
Potri.010G223600 139 / 3e-36 AT5G03250 683 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.008G038600 135 / 6e-35 AT5G03250 723 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.007G112600 134 / 2e-34 AT5G64330 989 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
Potri.011G091100 132 / 7e-34 AT1G30440 924 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.001G357100 131 / 2e-33 AT1G30440 971 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.017G048200 129 / 1e-32 AT5G64330 993 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
Potri.016G090400 128 / 2e-32 AT5G03250 768 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.005G146400 127 / 4e-32 AT2G14820 671 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03000 NPH3 NPH3 family
Representative CDS sequence
>Lus10030390 pacid=23153171 polypeptide=Lus10030390 locus=Lus10030390.g ID=Lus10030390.BGIv1.0 annot-version=v1.0
ATGAACAAAACATCCGCCGACCACCACCACCTGCCGCCGACCACCGCAAGCATCTGGTTCGACGACGCCTGCATCCTCGACATGGACTACTTCGTCAAGA
CCATAACCGGAATCAAATCCAAAGGCGTCCGGCCCGACCTCATCGGCTCAATCATCGCTCATTACGCCTCCAAATGGCTCCCTGAACTCTCACCCGACAA
CAACACCGCCGCCGCCGCCGCCGAAAAAGGCTGCGGAGAAAACATGACTACTGTGCTCGTCGTGGAGCACGTGACTCCGGTGGGTAAGTTATTTGGCGGT
AGGAAGGCGGCGGCGGAGGCGGCGGGGAAGGTGGGGAAGCTGGTGGATGGGTACCTGGCGGAGGTGGCGGTGGATTCGAATCTGGGGCTTTTGGAGTTTG
TGTCTCTTGCTGCTGCGGTTCCTCACCATGGCCGTACGATCGACGATGGGCTCTACCGTTCTATCAATACTTATCTCAAAGCACATCCAGGGGTGTCAAA
GCAAGAGAAGAAGAGCCTATGCAGGCTAATAGACAGCAGGAAGCTCTCACCAGAGGCATCCTTCCACGCTTCCCACAACGAAAGGCTACCGGTTCGAGTC
GTGATCCAAGTCCTCTTCGCCGAGCAAACCAAGCTCACAAGGCAACTCGACTGGAGCAGCGGCTCCTTCAACAACGACCTAAACCTCATGACTCGTTCGA
GCCCCAACCCTCGATCTTACAACAACAACAACATGGACCATCAAGTCACATCCACTCGATGCCACTCGAAGCGGGAGCTGAACGCCCAGCATTCGGAGAT
CAGGAAGCTGAAGGAAGACGTGGTGAGGCTGCAGAGCCAGTGCCTTAGCATGCAGAACCAGATGGGGAGGATGATGGCTGATCAGAAGAAGAAAAACAAT
GGTGGCCATGTGTTTAGCTACTGGAAGAAGTTAGGGTTCTCATCAACAACTTTCAAAACTAATTCAGGTGATCAGAAGGTGGTTGATCAATTTAATGAAG
GAAGATCATCAGATCATCATGGAGGAGAAGTTGTTATGGGAAAGGAAACTCCAGTTGTTGATAATATCAAGGCTAAACTTGTCAAGAAGAGGACTCCTCC
TCATAGGTGGAGAATATCCATGTCTTTAGATTATTGTACGTACTATAATATATATAATTAA
AA sequence
>Lus10030390 pacid=23153171 polypeptide=Lus10030390 locus=Lus10030390.g ID=Lus10030390.BGIv1.0 annot-version=v1.0
MNKTSADHHHLPPTTASIWFDDACILDMDYFVKTITGIKSKGVRPDLIGSIIAHYASKWLPELSPDNNTAAAAAEKGCGENMTTVLVVEHVTPVGKLFGG
RKAAAEAAGKVGKLVDGYLAEVAVDSNLGLLEFVSLAAAVPHHGRTIDDGLYRSINTYLKAHPGVSKQEKKSLCRLIDSRKLSPEASFHASHNERLPVRV
VIQVLFAEQTKLTRQLDWSSGSFNNDLNLMTRSSPNPRSYNNNNMDHQVTSTRCHSKRELNAQHSEIRKLKEDVVRLQSQCLSMQNQMGRMMADQKKKNN
GGHVFSYWKKLGFSSTTFKTNSGDQKVVDQFNEGRSSDHHGGEVVMGKETPVVDNIKAKLVKKRTPPHRWRISMSLDYCTYYNIYN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15570 Phototropic-responsive NPH3 fa... Lus10030390 0 1
AT1G12950 RSH2 root hair specific 2 (.1) Lus10036853 2.0 0.8585
AT3G24140 bHLH bHLH097, FMA FAMA, basic helix-loop-helix (... Lus10007139 2.2 0.8974
AT2G37010 ATNAP12 non-intrinsic ABC protein 12 (... Lus10023199 5.8 0.8682
Lus10040159 9.5 0.8494
Lus10035046 10.2 0.8584
AT2G37240 Thioredoxin superfamily protei... Lus10030907 10.4 0.8587
AT4G38840 SAUR-like auxin-responsive pro... Lus10009621 12.0 0.8489
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10006360 13.0 0.8495
AT4G00110 GAE3 UDP-D-glucuronate 4-epimerase ... Lus10031127 13.4 0.8353
Lus10026928 15.0 0.8480

Lus10030390 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.