Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037270 [exp] 53 / 4e-10 ND / Lus10009831 [exp] 48 / 6e-08 AT3G54200 54 / 2e-08 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10005256 [exp] 0 / 1 AT5G40010 501 / 4e-172 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030397 pacid=23153046 polypeptide=Lus10030397 locus=Lus10030397.g ID=Lus10030397.BGIv1.0 annot-version=v1.0 ATGGGTAGGTCATTTCCACTTCATGTTCGTTACCTCCCGGAAAAATTAAAGGTGGAACCAAAACCCATAGCTAACTCATCGGCGGTCATCTCCGCCGAGT CCATCGGGACCAGTGCCGTCAACGGGGCCAGGGTAGCCGACGACAAGACTGCCGCAGTTCCTTGGGCCGGTGCAGTCGGGGGTCGGACAGTCACAGCACC GATCGAATGCTCGCTGCCACCAACATCGATCTTCCTTCCGTCAAACAGTTTCCATCAATAA
AA sequence Show only first row Show all	>Lus10030397 pacid=23153046 polypeptide=Lus10030397 locus=Lus10030397.g ID=Lus10030397.BGIv1.0 annot-version=v1.0 MGRSFPLHVRYLPEKLKVEPKPIANSSAVISAESIGTSAVNGARVADDKTAAVPWAGAVGGRTVTAPIECSLPPTSIFLPSNSFHQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030397 [exp]	0	1
					Lus10011832 [exp]	4.0	1.0000
AT2G20420			ATP citrate lyase (ACL) family...		Lus10022902 [exp]	5.5	1.0000
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10025763 [exp]	7.1	1.0000
					Lus10027689 [exp]	7.2	1.0000
					Lus10027991 [exp]	13.6	1.0000
					Lus10009727 [exp]	15.0	1.0000
					Lus10003536 [exp]	15.9	1.0000
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10003908 [exp]	17.3	1.0000
AT4G19540		INDH, INDL	IND1(iron-sulfur protein requi...		Lus10011951 [exp]	18.7	1.0000
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10005236 [exp]	20.0	1.0000

Compare expression of checked genes

Lus10030397 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.