Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40100 94 / 5e-25 LHCB4.3 light harvesting complex photosystem II (.1.2) AT3G08940 80 / 2e-19 LHCB4.2 light harvesting complex photosystem II (.1.2) AT5G01530 78 / 3e-18 LHCB4.1 light harvesting complex photosystem II (.1) AT3G61470 53 / 4e-09 LHCA2 photosystem I light harvesting complex gene 2 (.1) AT1G19150 52 / 5e-09 LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA6, LHCA2*1, LHCA2*1, LHCA2*1, LH photosystem I light harvesting complex gene 6 (.1) AT1G45474 46 / 9e-07 LHCA5 photosystem I light harvesting complex gene 5 (.1.2) AT3G47470 42 / 2e-05 CAB4, LHCA4 light-harvesting chlorophyll-protein complex I subunit A4 (.1) AT1G15820 40 / 0.0001 CP24, LHCB6 light harvesting complex photosystem II subunit 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037836 [exp] 181 / 4e-58 AT2G40100 399 / 2e-141 light harvesting complex photosystem II (.1.2) Lus10028299 [exp] 94 / 4e-24 AT2G40100 412 / 7e-147 light harvesting complex photosystem II (.1.2) Lus10040191 [exp] 93 / 5e-24 AT2G40100 412 / 1e-146 light harvesting complex photosystem II (.1.2) Lus10035512 [exp] 81 / 4e-19 AT3G08940 459 / 4e-165 light harvesting complex photosystem II (.1.2) Lus10011361 [exp] 52 / 1e-08 AT3G61470 414 / 6e-148 photosystem I light harvesting complex gene 2 (.1) Lus10006416 [exp] 52 / 1e-08 AT3G61470 404 / 6e-144 photosystem I light harvesting complex gene 2 (.1) Lus10039912 [exp] 47 / 6e-07 AT1G19150 362 / 2e-127 photosystem I light harvesting complex gene 6 (.1) Lus10027649 [exp] 45 / 3e-06 AT1G19150 219 / 4e-72 photosystem I light harvesting complex gene 6 (.1) Lus10021730 [exp] 43 / 2e-05 AT1G45474 369 / 2e-130 photosystem I light harvesting complex gene 5 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G067300 [exp] 92 / 2e-23 AT2G40100 420 / 7e-150 light harvesting complex photosystem II (.1.2) Potri.006G099500 [exp] 77 / 5e-18 AT3G08940 474 / 7e-171 light harvesting complex photosystem II (.1.2) Potri.016G115200 [exp] 76 / 9e-18 AT3G08940 449 / 4e-161 light harvesting complex photosystem II (.1.2) Potri.006G139600 [exp] 51 / 2e-08 AT1G19150 393 / 1e-139 photosystem I light harvesting complex gene 6 (.1) Potri.001G056700 [exp] 49 / 1e-07 AT3G61470 410 / 3e-146 photosystem I light harvesting complex gene 2 (.1) Potri.003G171500 [exp] 49 / 1e-07 AT3G61470 409 / 5e-146 photosystem I light harvesting complex gene 2 (.1) Potri.014G029700 [exp] 44 / 5e-06 AT1G45474 306 / 3e-105 photosystem I light harvesting complex gene 5 (.1.2) Potri.003G020400 [exp] 41 / 7e-05 AT1G15820 421 / 9e-151 light harvesting complex photosystem II subunit 6 (.1) Potri.001G210000 [exp] 40 / 8e-05 AT1G15820 424 / 7e-152 light harvesting complex photosystem II subunit 6 (.1) Potri.015G062200 [exp] 40 / 0.0002 AT3G47470 442 / 2e-159 light-harvesting chlorophyll-protein complex I subunit A4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00504 [flax] [poplar] Chloroa_b-bind Chlorophyll A-B binding protein
Representative CDS sequence Show only first row Show all	>Lus10030403 pacid=23153079 polypeptide=Lus10030403 locus=Lus10030403.g ID=Lus10030403.BGIv1.0 annot-version=v1.0 ATGGTAAATACCGCATATTCCCCTGCTCCCACAACCCAATTCTCCGGCAGGACCCGGATCCAAACTCCACGACCCCACCTCCTACGGGTCCAGTCCCTCT TCAGTCGATTCCGAAAGATCAAGAAACCGGTAACTCCTCCACACCCTCCGCAGAAGAAGAAGGCCTCATCATCAATCTCAAAAGGAGGCAGCAGGCTTGT GTGGTTCCCTGGGGCCAAACCACCCGAGTGGCTCGACGGAACCATGGTTGGAGACCGCAGCTTCGACCCCCTCGGGTTCTCCAAGCCACCCGAGTACCTT CAGTTTGACTTTGACTCCCTTGACCAGAATCTTGCCAGGGGAGGTCATTGGGGTGATTAG
AA sequence Show only first row Show all	>Lus10030403 pacid=23153079 polypeptide=Lus10030403 locus=Lus10030403.g ID=Lus10030403.BGIv1.0 annot-version=v1.0 MVNTAYSPAPTTQFSGRTRIQTPRPHLLRVQSLFSRFRKIKKPVTPPHPPQKKKASSSISKGGSRLVWFPGAKPPEWLDGTMVGDRSFDPLGFSKPPEYL QFDFDSLDQNLARGGHWGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40100		LHCB4.3	light harvesting complex photo...		Lus10030403 [exp]	0	1
AT2G14100		CYP705A13	"cytochrome P450, family 705, ...		Lus10024582 [exp]	4.2	0.8886
AT5G04220		SYT3, NTMCTYPE1...	synaptotagmin 3, Calcium-depen...		Lus10023529 [exp]	7.5	0.8202
AT5G66780			unknown protein		Lus10024013 [exp]	8.7	0.8941
AT5G49340		TBL4	TRICHOME BIREFRINGENCE-LIKE 4 ...		Lus10016856 [exp]	12.0	0.8421
AT5G03170		ATFLA11, FLA11,...	ARABIDOPSIS FASCICLIN-LIKE ARA...		Lus10002984 [exp]	12.2	0.8563
AT2G37240			Thioredoxin superfamily protei...		Lus10019900 [exp]	12.3	0.8471
AT4G16160		ATOEP16-2, ATOE...	Mitochondrial import inner mem...		Lus10016878 [exp]	13.2	0.8089
AT5G60490		FLA12	FASCICLIN-like arabinogalactan...		Lus10002985 [exp]	15.5	0.8389
AT5G18470			Curculin-like (mannose-binding...		Lus10004765 [exp]	15.9	0.8159
AT2G36640		ATECP63	embryonic cell protein 63 (.1)		Lus10035586 [exp]	17.0	0.8234

Compare expression of checked genes

Lus10030403 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.