Lus10030406 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G55490 158 / 9e-51 GINS complex protein (.1)
AT1G19080 158 / 9e-51 PSF3, TTN10 TITAN 10, Partner of SLD5 3, GINS complex protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014848 207 / 4e-71 AT1G19080 157 / 3e-50 TITAN 10, Partner of SLD5 3, GINS complex protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G189200 181 / 4e-60 AT3G55490 271 / 8e-94 GINS complex protein (.1)
Potri.008G068100 178 / 1e-58 AT3G55490 273 / 1e-94 GINS complex protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05916 Sld5 GINS complex protein
Representative CDS sequence
>Lus10030406 pacid=23153122 polypeptide=Lus10030406 locus=Lus10030406.g ID=Lus10030406.BGIv1.0 annot-version=v1.0
ATGGCGGATTACTACGAAATTGATGATATTCTTGCTGAAGAAGAGTTTGTACCTGTCCTATTTCACAAGGCGGTGAATGGGGTTAAAATCGACGAAAGTT
CAGAAAGAGGCTTTGTTGAGAAAGATTCCAAGTCGGAGCTACCATTTTGGCTTGCTCGCGAGTTACACTTGAGACAAGCCGTATCAATCAAAGTTCCTGC
CTGTTTCAATAGACAAACGAGGCTAGAAATCGAGGCTGATGCTGGATCTGTTGATTTACGATCCCGCTGTTCATACTTCTATGAATTTGGATGTAAACTC
GCACCATAG
AA sequence
>Lus10030406 pacid=23153122 polypeptide=Lus10030406 locus=Lus10030406.g ID=Lus10030406.BGIv1.0 annot-version=v1.0
MADYYEIDDILAEEEFVPVLFHKAVNGVKIDESSERGFVEKDSKSELPFWLARELHLRQAVSIKVPACFNRQTRLEIEADAGSVDLRSRCSYFYEFGCKL
AP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G19080 PSF3, TTN10 TITAN 10, Partner of SLD5 3, G... Lus10030406 0 1
AT3G19210 ATRAD54, CHR25 homolog of RAD54 (.1.2) Lus10019866 8.4 0.9234
AT4G21820 binding;calmodulin binding (.1... Lus10007665 12.2 0.9223
AT5G08020 ATRPA70B ARABIDOPSIS THALIANA RPA70-KDA... Lus10021153 18.5 0.9087
AT3G25100 CDC45 cell division cycle 45 (.1) Lus10011840 25.3 0.9027
AT3G51280 Tetratricopeptide repeat (TPR)... Lus10028433 26.9 0.9076
AT1G08560 KN, ATSYP111, S... KNOLLE, syntaxin of plants 11... Lus10042527 31.6 0.8951
AT5G44635 MCM6 MINICHROMOSOME MAINTENANCE 6, ... Lus10038384 31.6 0.8986
AT2G33340 MAC3B MOS4-associated complex 3B (.... Lus10023728 32.2 0.8938
AT1G59540 ZCF125 P-loop containing nucleoside t... Lus10018661 34.1 0.8955
AT5G19330 ARIA ARM repeat protein interacting... Lus10042583 37.5 0.8931

Lus10030406 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.