Lus10030412 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55050 46 / 6e-07 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT5G18430 40 / 0.0001 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026644 138 / 2e-41 AT4G28780 113 / 2e-28 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10026647 59 / 4e-11 AT5G55050 159 / 4e-45 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10004668 58 / 5e-11 AT5G55050 184 / 6e-55 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10040065 54 / 1e-10 AT5G55050 99 / 4e-26 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10030411 56 / 3e-10 AT5G55050 158 / 1e-44 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10023980 56 / 4e-10 AT5G55050 215 / 1e-66 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10021540 53 / 4e-09 AT5G55050 357 / 5e-122 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10025104 52 / 9e-09 AT5G55050 211 / 3e-65 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10030410 51 / 2e-08 AT5G55050 147 / 1e-40 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G180400 48 / 2e-07 AT4G28780 200 / 4e-61 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.011G089700 44 / 7e-06 AT5G55050 375 / 3e-129 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.018G008100 38 / 0.0005 AT1G29670 345 / 8e-118 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10030412 pacid=23140771 polypeptide=Lus10030412 locus=Lus10030412.g ID=Lus10030412.BGIv1.0 annot-version=v1.0
ATGGCGACAAAACCGGTGACCGCAATCCTCTACCTCCTGTGGATGTTGGTGGCGACGAATCCGCCACTTCAGTGTTCATCTCTGGAGGATGAAGACGGGG
ATGAAGCCTACAAAATCGAAGATCCTCCGGTTTGTGGGATCTTCATGGGTGGCACCGCTGTTGAGGTCGGGACGAACAACTACTTGAGTTTAAGCACCGC
AAAGCTTAACTTCCCTCCGAATGGGATCGATTTTCCGAACTCGAGGCCACCGGAAGATTTAGCGACGGCTATACTATGGCCGACTATATTGGTAAATGTT
ACTGTTGCAGTAGTTTCTCTCATCTGA
AA sequence
>Lus10030412 pacid=23140771 polypeptide=Lus10030412 locus=Lus10030412.g ID=Lus10030412.BGIv1.0 annot-version=v1.0
MATKPVTAILYLLWMLVATNPPLQCSSLEDEDGDEAYKIEDPPVCGIFMGGTAVEVGTNNYLSLSTAKLNFPPNGIDFPNSRPPEDLATAILWPTILVNV
TVAVVSLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10030412 0 1

Lus10030412 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.