Lus10030421 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69390 249 / 9e-84 ARC12, ATMINE1 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026638 427 / 4e-154 AT1G69390 247 / 4e-83 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Lus10036802 307 / 1e-106 AT1G69390 253 / 3e-85 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Lus10037128 295 / 4e-102 AT1G69390 256 / 2e-86 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G162600 302 / 7e-105 AT1G69390 272 / 5e-93 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Potri.008G092300 296 / 1e-102 AT1G69390 270 / 2e-92 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Potri.004G121000 184 / 8e-59 AT1G69390 191 / 2e-61 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Potri.017G088401 86 / 1e-21 AT1G69390 86 / 2e-22 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03776 MinE Septum formation topological specificity factor MinE
Representative CDS sequence
>Lus10030421 pacid=23140662 polypeptide=Lus10030421 locus=Lus10030421.g ID=Lus10030421.BGIv1.0 annot-version=v1.0
ATGGCGATCTCAGGAGATCTGAGTGTCTCTGCAGCATTGGCATCCTATCCTAAGCACCAGCCTCTCAGAAGCTTGCCTCTTTCATCGACATCAAAGGTGG
ACTTCAACGCATTCCCCAGCGGAAGATCAGCAACCACCATCACAATTTCGAACCGTAAACCAACCCCTTCCATCCAACTATCCGCCGCCACCTCCAAAGA
TTACGAGATGTCCTCCTCAGCCACCACATTCAACCAAGACGCCGAGACCTTCCTCCTCAACGCCATAAACATGAGCCTCCTCGAACGACTCACCTTAGCC
TGGAAGCTAATCTTCCCATCACCCGCCAGACAAAAGACCTCCAACGCAAGGATAGCCAAGCAGCGCCTCAAGATGATCCTCTTCTCCGACCGGTGTGCAG
TTAGCGACGAGGCCAAGAGGAAGATCGTCAACAACATCGTTCACGCCCTCTCCGAGTTCGTCGAGATCGAGTCCCAGGACAAAGTGCAGCTCAGTGTCAC
TACCGACACCGACTTGGGGACGATGTACTCGGTTACGGTTCCCGTTCGAAGAGTGAAGGCGGAGTACCTGGAAATCGAGGATGTTGGATCGATTACTAAC
ATCGAGTATAGAGAAACCGGACTGGATGATGATTCGGTCGATGTTACGTTCGACTTCTACATTCCGGATGAAAGGACTCGGTGA
AA sequence
>Lus10030421 pacid=23140662 polypeptide=Lus10030421 locus=Lus10030421.g ID=Lus10030421.BGIv1.0 annot-version=v1.0
MAISGDLSVSAALASYPKHQPLRSLPLSSTSKVDFNAFPSGRSATTITISNRKPTPSIQLSAATSKDYEMSSSATTFNQDAETFLLNAINMSLLERLTLA
WKLIFPSPARQKTSNARIAKQRLKMILFSDRCAVSDEAKRKIVNNIVHALSEFVEIESQDKVQLSVTTDTDLGTMYSVTVPVRRVKAEYLEIEDVGSITN
IEYRETGLDDDSVDVTFDFYIPDERTR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Lus10030421 0 1
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Lus10026638 1.4 0.8893
AT3G46630 Protein of unknown function (D... Lus10018738 8.1 0.8540
AT5G23140 NCLPP7, NCLPP2,... nuclear-encoded CLP protease P... Lus10013435 10.6 0.8682
AT1G32360 C3HZnF Zinc finger (CCCH-type) family... Lus10000486 16.0 0.7961
AT2G23820 Metal-dependent phosphohydrola... Lus10015497 20.8 0.8308
AT3G55140 Pectin lyase-like superfamily ... Lus10030313 24.0 0.8098
AT4G35000 APX3 ascorbate peroxidase 3 (.1) Lus10019781 24.8 0.8182
AT3G46630 Protein of unknown function (D... Lus10024797 26.0 0.8392
AT5G58250 EMB3143 EMBRYO DEFECTIVE 3143, unknown... Lus10035110 29.7 0.8380
AT1G03600 PSB27 photosystem II family protein ... Lus10037438 30.4 0.8304

Lus10030421 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.