Lus10030465 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14205 174 / 1e-56 Ribosomal L18p/L5e family protein (.1)
AT1G48350 77 / 2e-18 EMB3105 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012820 270 / 4e-94 AT1G14205 182 / 2e-59 Ribosomal L18p/L5e family protein (.1)
Lus10039092 76 / 9e-18 AT1G48350 216 / 6e-73 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Lus10038770 75 / 1e-17 AT1G48350 216 / 6e-73 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G087100 176 / 1e-57 AT1G14205 202 / 2e-67 Ribosomal L18p/L5e family protein (.1)
Potri.010G005000 75 / 1e-17 AT1G48350 229 / 4e-78 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Lus10030465 pacid=23140566 polypeptide=Lus10030465 locus=Lus10030465.g ID=Lus10030465.BGIv1.0 annot-version=v1.0
ATGAGCTTGGTTGCAAGTTCGAGGAAGAACACCAAAACGGAGAGCGCCAAAACCCTTAACAGGAGGAGGCAAAACAAGTTCAATGGGACGCCTTTGAAAC
CGAGGCTGTCGGTGTTCAGTTCAGGGAAGCAGCTGTATGCAATGCTGGTGGATGATCAGAACAAGAAGAGCTTGTTCTACGGGAGCACCTTGCAGAAGTC
GATTCGTGGCGACCTGCCTTGTTCCGCCATTGAAGCTGCTGAAAGGCTGGGTGAGGAGGTGATCAAGGCGTGTGTTGAGCTCGAGATCGAGGAAGTGTCA
TACGATCGGAATGGGAATCCGGCTCGTGGGGAGAAGATGCAGGCGTTCGAGACTGTGATTTCTCGACACGGCTTCTTGCCTGATCGAGCGACAAGGTCTC
GACGGGTTCCTGCGACATCGTCTTAG
AA sequence
>Lus10030465 pacid=23140566 polypeptide=Lus10030465 locus=Lus10030465.g ID=Lus10030465.BGIv1.0 annot-version=v1.0
MSLVASSRKNTKTESAKTLNRRRQNKFNGTPLKPRLSVFSSGKQLYAMLVDDQNKKSLFYGSTLQKSIRGDLPCSAIEAAERLGEEVIKACVELEIEEVS
YDRNGNPARGEKMQAFETVISRHGFLPDRATRSRRVPATSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14205 Ribosomal L18p/L5e family prot... Lus10030465 0 1
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10034300 2.4 0.9618
AT5G52400 CYP715A1 "cytochrome P450, family 715, ... Lus10027480 7.5 0.9612
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10033385 8.2 0.9325
Lus10024873 8.5 0.9577
AT5G49630 AAP6 amino acid permease 6 (.1) Lus10007235 9.2 0.9581
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006700 10.7 0.9299
AT1G14205 Ribosomal L18p/L5e family prot... Lus10012820 15.9 0.9410
AT4G23690 Disease resistance-responsive ... Lus10024714 18.8 0.9557
AT2G43820 SGT1, ATSAGT1, ... UDP-glucose:salicylic acid glu... Lus10017826 21.1 0.8966
AT5G14040 PHT3;1 phosphate transporter 3;1 (.1) Lus10036014 23.6 0.9513

Lus10030465 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.