Lus10030468 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G02990 337 / 2e-118 RNS1, ATRNS1 ribonuclease 1 (.1)
AT1G14220 291 / 2e-100 Ribonuclease T2 family protein (.1)
AT1G26820 287 / 5e-99 RNS3 ribonuclease 3 (.1)
AT1G14210 220 / 4e-72 Ribonuclease T2 family protein (.1)
AT2G39780 125 / 5e-35 RNS2 ribonuclease 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012823 416 / 1e-149 AT2G02990 334 / 2e-117 ribonuclease 1 (.1)
Lus10027978 286 / 1e-98 AT1G14220 330 / 4e-116 Ribonuclease T2 family protein (.1)
Lus10003110 129 / 7e-37 AT1G26820 142 / 4e-42 ribonuclease 3 (.1)
Lus10035881 123 / 2e-34 AT2G02990 130 / 4e-37 ribonuclease 1 (.1)
Lus10035882 122 / 2e-34 AT1G14220 128 / 1e-36 Ribonuclease T2 family protein (.1)
Lus10041084 105 / 1e-26 AT2G39780 306 / 2e-104 ribonuclease 2 (.1.2)
Lus10036409 86 / 9e-20 AT2G39780 276 / 5e-94 ribonuclease 2 (.1.2)
Lus10022385 82 / 3e-18 AT1G26820 92 / 2e-21 ribonuclease 3 (.1)
Lus10015409 71 / 2e-14 AT1G14220 79 / 8e-18 Ribonuclease T2 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G086700 352 / 1e-124 AT2G02990 310 / 8e-108 ribonuclease 1 (.1)
Potri.010G168700 341 / 3e-120 AT2G02990 337 / 2e-118 ribonuclease 1 (.1)
Potri.008G086800 279 / 1e-95 AT1G26820 288 / 1e-99 ribonuclease 3 (.1)
Potri.010G168600 144 / 5e-44 AT1G26820 147 / 1e-45 ribonuclease 3 (.1)
Potri.014G174400 125 / 5e-35 AT2G39780 371 / 5e-131 ribonuclease 2 (.1.2)
Potri.006G118200 84 / 2e-21 AT2G02990 86 / 3e-22 ribonuclease 1 (.1)
Potri.013G134400 83 / 1e-18 AT2G02990 82 / 4e-18 ribonuclease 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00445 Ribonuclease_T2 Ribonuclease T2 family
Representative CDS sequence
>Lus10030468 pacid=23140675 polypeptide=Lus10030468 locus=Lus10030468.g ID=Lus10030468.BGIv1.0 annot-version=v1.0
ATGATGATGAAGCCAGTAGCCATGAACATCCTCCTCCTCCAAGCTTTGGTGGCCTTGGCCCTAACGGGGCTCTCTGTTTCAAAGAATTTCGATTTCTTCT
ACTTCGTCCAACAGTGGCCGGGGTCGTACTGTGACACACAAAAGAGCTGTTGTTATCCAACGACCGGGAAGCCAGCTGCTGATTTCGGGGTTCATGGGTT
GTGGCCGAATTATAATGACGGTACTTACCCTTCGAACTGCGACTCCGGTAGCCCTTTTGTCCAATCAAAGGTTTCTGATTTGATCAGCTCAATGCAAAAG
AACTGGCCAACTCTAGCTTGCCCTAGTGGGAATGGAGTTACATTCTGGACTCACGAATGGGAGAAGCATGGCACATGCTCAGAAGATGTGTTGGATCAAC
ATAGCTACTTTGCGAACGCTCTCAGCTTGCAGAGCCAGACTAGACTTCTTGAAGCTCTAACAAGTTCAGGAATCAATCCAGATGGGCAATCATATAGTTT
GACAGACATCAAGAGCGCCATTCAGGGAAAAGTGGGGTACACTCCTTATATCGAGTGCAACAACGATGAATCGGGAAACAGCCAACTATATCAAGTGTAC
TTATGCGTGGATAGTTCCGGATCGAATCTTATCGAGTGCCCCATTTTTCCTCACGGAAAATGCGGCTCCGAGATCGAGTTCCCTACCTTTTAG
AA sequence
>Lus10030468 pacid=23140675 polypeptide=Lus10030468 locus=Lus10030468.g ID=Lus10030468.BGIv1.0 annot-version=v1.0
MMMKPVAMNILLLQALVALALTGLSVSKNFDFFYFVQQWPGSYCDTQKSCCYPTTGKPAADFGVHGLWPNYNDGTYPSNCDSGSPFVQSKVSDLISSMQK
NWPTLACPSGNGVTFWTHEWEKHGTCSEDVLDQHSYFANALSLQSQTRLLEALTSSGINPDGQSYSLTDIKSAIQGKVGYTPYIECNNDESGNSQLYQVY
LCVDSSGSNLIECPIFPHGKCGSEIEFPTF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G02990 RNS1, ATRNS1 ribonuclease 1 (.1) Lus10030468 0 1
AT5G16990 Zinc-binding dehydrogenase fam... Lus10010989 1.0 0.8636
AT2G02990 RNS1, ATRNS1 ribonuclease 1 (.1) Lus10012823 1.7 0.8383
AT2G46950 CYP709B2 "cytochrome P450, family 709, ... Lus10019186 8.5 0.7828
AT3G14620 CYP72A8 "cytochrome P450, family 72, s... Lus10019185 11.1 0.7515
AT3G14360 alpha/beta-Hydrolases superfam... Lus10037465 14.2 0.8444
AT1G80930 MIF4G domain-containing protei... Lus10002210 19.6 0.8181
AT1G30870 Peroxidase superfamily protein... Lus10020864 25.2 0.7592
AT1G10385 Vps51/Vps67 family (components... Lus10033648 36.9 0.7486
AT1G22340 ATUGT85A7 UDP-glucosyl transferase 85A7 ... Lus10035921 37.4 0.8167
AT3G25810 Terpenoid cyclases/Protein pre... Lus10025922 50.4 0.7388

Lus10030468 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.