Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02955 110 / 9e-30 MEE12 maternal effect embryo arrest 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034719 [exp] 177 / 1e-54 AT2G02955 370 / 5e-121 maternal effect embryo arrest 12 (.1) Lus10021646 [exp] 171 / 1e-51 AT2G02955 442 / 4e-147 maternal effect embryo arrest 12 (.1) Lus10016251 [exp] 152 / 2e-49 AT2G02955 114 / 6e-31 maternal effect embryo arrest 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G169500 [exp] 127 / 2e-35 AT2G02955 513 / 5e-174 maternal effect embryo arrest 12 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030475 pacid=23140733 polypeptide=Lus10030475 locus=Lus10030475.g ID=Lus10030475.BGIv1.0 annot-version=v1.0 ATGGAGGAGAACCGGTTCTGTTACATCCCGCCAAGGTGCAACGTGAAAGAACCTGACAAATACCTCTATTACAATAGGAAGCAGGACGAGGGATCGTACA GGTACATTGCTCACGCGGATTACTACATCCTGCTGCGATCCTGCGCGAAGGTAGTGCAGGTCGACATCAGGATCAAGCACATTGGGGTGATGGGTTTCGA GAGGAGGTTGGCTTGGTTGGAGAAGATGATTGAGTATTCCGCGCATTTGAATCCTCCGAGTTTTACTTGTGAGTTCAGTAGAGATGATGATGATACAGCT ACTGGGTAG
AA sequence Show only first row Show all	>Lus10030475 pacid=23140733 polypeptide=Lus10030475 locus=Lus10030475.g ID=Lus10030475.BGIv1.0 annot-version=v1.0 MEENRFCYIPPRCNVKEPDKYLYYNRKQDEGSYRYIAHADYYILLRSCAKVVQVDIRIKHIGVMGFERRLAWLEKMIEYSAHLNPPSFTCEFSRDDDDTA TG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02955		MEE12	maternal effect embryo arrest ...		Lus10030475 [exp]	0	1
AT1G63740			Disease resistance protein (TI...		Lus10010546 [exp]	5.2	0.6930
AT2G40220	AP2_ERF	ATABI4, GIN6, S...	SUCROSE UNCOUPLED 6, SUGAR-INS...		Lus10009834 [exp]	14.3	0.6603
					Lus10017936 [exp]	28.9	0.6567
AT4G15480		UGT84A1	UDP-Glycosyltransferase superf...		Lus10002810 [exp]	35.1	0.6077
					Lus10019746 [exp]	38.4	0.5812
AT3G08980			Peptidase S24/S26A/S26B/S26C f...		Lus10004822 [exp]	43.3	0.6169
					Lus10021617 [exp]	82.0	0.5341
AT3G43660			Vacuolar iron transporter (VIT...		Lus10029776 [exp]	117.1	0.5493
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10004347 [exp]	124.4	0.5524
AT4G02160			unknown protein		Lus10010018 [exp]	128.4	0.5431

Compare expression of checked genes

Lus10030475 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.