Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65870 163 / 4e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G58170 163 / 4e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 154 / 2e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT5G49040 152 / 9e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 149 / 1e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 135 / 5e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 127 / 3e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 127 / 5e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49030 131 / 3e-35 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3) AT3G13662 120 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026176 [exp] 191 / 5e-62 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 191 / 8e-62 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 172 / 2e-54 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 155 / 4e-48 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10016231 [exp] 142 / 6e-43 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 139 / 1e-41 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021083 [exp] 132 / 1e-38 AT1G22900 150 / 5e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10039561 [exp] 130 / 6e-38 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029312 [exp] 121 / 6e-35 AT3G13660 135 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G216400 [exp] 198 / 8e-65 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216300 [exp] 197 / 3e-64 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G061000 [exp] 181 / 7e-58 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G009100 [exp] 175 / 8e-56 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 165 / 6e-52 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.006G195300 [exp] 165 / 1e-51 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216200 [exp] 165 / 1e-51 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G060900 [exp] 159 / 1e-49 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 140 / 2e-42 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023800 [exp] 135 / 3e-40 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10030483 pacid=23140617 polypeptide=Lus10030483 locus=Lus10030483.g ID=Lus10030483.BGIv1.0 annot-version=v1.0 ATGGCTAAACTCAACCAAATCATAGCTTCCATCTTCATAATCTCCACCCTTCTCTCAACCATATCCCAAGCTGATCACCCCGACGACGATTATGTCAAAA CCCTGAACCCTAAACGTCTAAATAAGATGTTCAGGTCTCAGAAGAAGCTGACCCACTTCCACTTTTTTTGGCATGATATCTATAGTGGAGCCACCCCATC TGCAATGCAGGTGGTGGCCTCCCCCTCGAACACCTCCCAAACAGGGTTCGGATTCGTGAGCATGATTGACAACCCAATGACAATGGGCCCACAGCTGGAT GTCTCGAACTCGTCCAACTTGATGGGGAGGGCTCAAGGGTTCTATGGGTCGGCCGACCATAGCGAGTTGGCGGTGATGGTAGTGATGAACTTGGTGTTCT TGCAAGGGAAGTACAACCAGAGCACGGTGACGTTGATGGGGAGGAACAGGATTGCGGCGGAGGTGCGGGAGACTGCGGTGGTCGGCGGGACTGGAGTTTT TCGATTCGCGTCCGGGTTTGCGACCGCAAGTACTTTTCGGTTCAACCAGACGAGTGGGGATGCTGTGGCTGAGTATGATTTGTACGTGTTGCATTATTGA
AA sequence Show only first row Show all	>Lus10030483 pacid=23140617 polypeptide=Lus10030483 locus=Lus10030483.g ID=Lus10030483.BGIv1.0 annot-version=v1.0 MAKLNQIIASIFIISTLLSTISQADHPDDDYVKTLNPKRLNKMFRSQKKLTHFHFFWHDIYSGATPSAMQVVASPSNTSQTGFGFVSMIDNPMTMGPQLD VSNSSNLMGRAQGFYGSADHSELAVMVVMNLVFLQGKYNQSTVTLMGRNRIAAEVRETAVVGGTGVFRFASGFATASTFRFNQTSGDAVAEYDLYVLHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65870			Disease resistance-responsive ...		Lus10030483 [exp]	0	1
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10001775 [exp]	2.8	0.8653
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Lus10027062 [exp]	3.5	0.8413
AT4G03230			S-locus lectin protein kinase ...		Lus10039725 [exp]	4.6	0.8068
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10040354 [exp]	4.9	0.8047
AT5G24090		ATCHIA	chitinase A (.1)		Lus10027560 [exp]	8.2	0.8615
AT1G32100		ATPRR1	pinoresinol reductase 1 (.1)		Lus10012145 [exp]	11.2	0.8293
AT2G23600		ATMES2, ACL, AT...	ARABIDOPSIS THALIANA METHYL ES...		Lus10038593 [exp]	11.3	0.7848
AT5G01740			Nuclear transport factor 2 (NT...		Lus10022755 [exp]	14.7	0.7671
AT3G19920			unknown protein		Lus10017384 [exp]	23.7	0.7961
AT5G42500			Disease resistance-responsive ...		Lus10032939 [exp]	49.3	0.8229

Compare expression of checked genes

Lus10030483 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.