Lus10030484 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25810 394 / 2e-139 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 392 / 2e-138 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57560 385 / 1e-135 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G30270 358 / 4e-125 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57530 348 / 5e-121 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57540 347 / 2e-120 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT2G18800 347 / 2e-120 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT4G25820 345 / 9e-120 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT3G23730 341 / 2e-118 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 339 / 1e-117 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012834 400 / 1e-141 AT5G57550 292 / 5e-99 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
Lus10028947 344 / 1e-119 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10000678 344 / 2e-119 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 342 / 6e-119 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10021638 342 / 8e-119 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 341 / 3e-118 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 340 / 9e-118 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031392 338 / 5e-117 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 325 / 5e-112 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G095100 394 / 2e-139 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 393 / 5e-138 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 390 / 1e-137 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G094800 389 / 3e-137 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.005G007200 380 / 1e-133 AT4G25810 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G094900 367 / 1e-128 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G071200 367 / 2e-128 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.014G146100 352 / 1e-122 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201200 349 / 3e-121 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 348 / 6e-121 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10030484 pacid=23140639 polypeptide=Lus10030484 locus=Lus10030484.g ID=Lus10030484.BGIv1.0 annot-version=v1.0
ATGGCGACACCCACCTCCAACACCCCTTTCCTACTCCTCTCAATCACCCTCATCATCACCACCACCATCGCGGCTCAGACCAATCTGGACCGCGAATTCG
ACCTCACGTGGGGAGAAGGCCGCGGCAAGATCGTTGCCGACGGCCAGTTGCTCACCCTGACCCTCGATCACACTTCGGGGTCAGGGTTCCAGTCCAAGAA
CAAGTACCTGTACGGGAAGCTCGACATGCAGCTGAAGCTAGTCCCCGGCAACTCTGCTGGCACCGTTACTGCTTACTTCTTGAAGTCTGATGGAGATGCG
TGGGACGAGATTGATTATGAGTTCTTGGGGAACTTGAGTGGCGATCCTTACACGGTCCATACGAACGTGTTCACGAACGGGAAAGGCGATCGGGAGCAGC
AGTTTCGTCTTTGGTTCGATCCGACGACTGATTTTCATACTTACTCGATCCTTTGGAACCCCAAGAGCATCGTTTTCACCATCGACGGCACACCGATCAG
AGAATTCAAGAACCTGGAATCCGTCGGAGTCCCCTTCCCAACATCACAACCCATGAGGCTCTACTCGAGCCTATGGAGCGCCGACGACTGGGCCACCAGG
GGAGGGACCCTGAAGACCGACTGGTCCCAGGCTCCGTTCTCGGCCTCCTACAAAGACTTCAAAGCAGGGGAGGCCTGCATAGTGAATAACGATGGAGCGA
ACCCAACTTGCTCGCCTGCCGGTAGCACGTCTTGGCTTAACGAGCAGCTGAACTCGGTGAACGAGCAGCGGATGAGGTCGGTCCAGAGCCATTACATGAT
CTACAACTACTGTACTGATTCGGAGAGGTTTCCTCAGGGGTTCCCTAAAGAGTGTACTGCAGAATGA
AA sequence
>Lus10030484 pacid=23140639 polypeptide=Lus10030484 locus=Lus10030484.g ID=Lus10030484.BGIv1.0 annot-version=v1.0
MATPTSNTPFLLLSITLIITTTIAAQTNLDREFDLTWGEGRGKIVADGQLLTLTLDHTSGSGFQSKNKYLYGKLDMQLKLVPGNSAGTVTAYFLKSDGDA
WDEIDYEFLGNLSGDPYTVHTNVFTNGKGDREQQFRLWFDPTTDFHTYSILWNPKSIVFTIDGTPIREFKNLESVGVPFPTSQPMRLYSSLWSADDWATR
GGTLKTDWSQAPFSASYKDFKAGEACIVNNDGANPTCSPAGSTSWLNEQLNSVNEQRMRSVQSHYMIYNYCTDSERFPQGFPKECTAE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Lus10030484 0 1
AT2G38870 Serine protease inhibitor, pot... Lus10014740 1.0 0.9558
AT2G36780 UDP-Glycosyltransferase superf... Lus10014402 1.7 0.8915
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Lus10038282 2.8 0.9103
AT3G61490 Pectin lyase-like superfamily ... Lus10036383 3.5 0.8859
AT5G62730 Major facilitator superfamily ... Lus10033101 5.7 0.7627
Lus10040690 6.3 0.8779
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Lus10030567 6.5 0.8004
AT4G19460 UDP-Glycosyltransferase superf... Lus10033297 7.9 0.8489
AT2G39980 HXXXD-type acyl-transferase fa... Lus10040222 8.8 0.8159
AT1G68040 S-adenosyl-L-methionine-depend... Lus10013484 9.8 0.7245

Lus10030484 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.