Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 115 / 2e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G17680 108 / 5e-27 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G72840 107 / 1e-26 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G72920 98 / 8e-25 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G27170 100 / 4e-24 transmembrane receptors;ATP binding (.1.2) AT1G72940 97 / 1e-23 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G40100 98 / 2e-23 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G44630 97 / 5e-23 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT3G44480 96 / 8e-23 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G69550 96 / 9e-23 disease resistance protein (TIR-NBS-LRR class) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012852 [exp] 208 / 2e-67 AT5G17680 100 / 1e-23 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10009500 [exp] 155 / 5e-48 AT1G72940 115 / 4e-30 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) Lus10014671 [exp] 133 / 2e-38 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10029921 [exp] 135 / 4e-38 AT5G36930 105 / 7e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10006929 [exp] 132 / 7e-38 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10026845 [exp] 130 / 6e-37 AT5G36930 145 / 8e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10027920 [exp] 127 / 4e-35 AT5G36930 139 / 3e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004482 [exp] 124 / 2e-34 AT1G56540 111 / 2e-27 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10029919 [exp] 122 / 2e-34 AT5G36930 105 / 5e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T002568 [exp] 120 / 1e-31 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G004500 [exp] 114 / 3e-31 AT5G36930 152 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G016425 [exp] 117 / 2e-30 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001602 [exp] 113 / 6e-29 AT5G36930 778 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.017G105501 [exp] 106 / 6e-29 AT5G36930 158 / 4e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 113 / 8e-29 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 112 / 1e-28 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G068300 [exp] 112 / 1e-28 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G019710 [exp] 111 / 2e-28 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G070436 [exp] 105 / 2e-28 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10030498 pacid=23140737 polypeptide=Lus10030498 locus=Lus10030498.g ID=Lus10030498.BGIv1.0 annot-version=v1.0 ATGGGCAACCAACACGACGTGTTTGTAAGCTTCCGAGGCCGGGACGTGCGGTACAAGTTCGTGGACCATCTCTTCGCCGCACTCCGGAGGAACAAGGTGA CGGCATTCAGGGATGACCGCAACTTACGCCGAGGAGAAAGCATTGAGGACGGTGTTCGAAGGGCCATCGAGAAGTCGAGCTTTTACGTTGTTGTTTTGAC ACCCAACTACACTTCCTCTCCGTGGTGCTTGGATGAGCTTGTCAAAATGATGAAATGCTCTACTAGTAGTAGGAGTAGGGAAGGAGCATCTAGATCCAAG ATGATCTTTCTCATTTTTTATCATGTGGCGCCGGAGGATGTCTCCCAGTACTGCTACCGTGAGGTTGATGGTGTTAACCAAAACGAAATACCGTCCACAA AGGAGAGAGCCGACACATGGGTAAAGGCACTTGATTGGATTGTTGGCATTGCTGGCTGGGTCGTCAATAACGGACATGTTCAAAATATTGTACTGACCGA AGCGTTGATAATGCAGGTCAGAGGCATCGTTGGTAGAGAGCATTGCCAGAATCATGCGACGAAATTTTCGAACTGTGGTGGCTCGACGGTGGCTAAAGAA GAGTCGTGCCGGCAATGGAAAGAGAAAACCAATTAA
AA sequence Show only first row Show all	>Lus10030498 pacid=23140737 polypeptide=Lus10030498 locus=Lus10030498.g ID=Lus10030498.BGIv1.0 annot-version=v1.0 MGNQHDVFVSFRGRDVRYKFVDHLFAALRRNKVTAFRDDRNLRRGESIEDGVRRAIEKSSFYVVVLTPNYTSSPWCLDELVKMMKCSTSSRSREGASRSK MIFLIFYHVAPEDVSQYCYREVDGVNQNEIPSTKERADTWVKALDWIVGIAGWVVNNGHVQNIVLTEALIMQVRGIVGREHCQNHATKFSNCGGSTVAKE ESCRQWKEKTN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10030498 [exp]	0	1
AT3G46290		HERK1	hercules receptor kinase 1 (.1...		Lus10012647 [exp]	1.0	0.9954
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10027345 [exp]	1.4	0.9909
AT1G45160			Protein kinase superfamily pro...		Lus10005470 [exp]	1.7	0.9863
AT4G16730		AtTPS02	terpene synthase 02 (.1)		Lus10006357 [exp]	2.8	0.9801
AT5G39160			RmlC-like cupins superfamily p...		Lus10034254 [exp]	7.9	0.9593
					Lus10016111 [exp]	8.2	0.9194
AT3G24503		ALDH1A, REF1, A...	REDUCED EPIDERMAL FLUORESCENCE...		Lus10024260 [exp]	8.5	0.9593
AT5G41850			alpha/beta-Hydrolases superfam...		Lus10023100 [exp]	13.3	0.9479
AT2G35190		NSPN11, ATNPSN1...	novel plant snare 11 (.1)		Lus10003004 [exp]	16.4	0.9711
					Lus10032968 [exp]	18.7	0.9598

Compare expression of checked genes

Lus10030498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.