Lus10030510 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G40780 119 / 1e-34 Nucleic acid-binding, OB-fold-like protein (.1.2)
AT2G40910 47 / 1e-06 F-box and associated interaction domains-containing protein (.1.2)
AT2G04520 40 / 0.0002 Nucleic acid-binding, OB-fold-like protein (.1)
AT5G35680 39 / 0.0003 Nucleic acid-binding, OB-fold-like protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029014 163 / 5e-52 AT2G40780 199 / 4e-66 Nucleic acid-binding, OB-fold-like protein (.1.2)
Lus10034249 160 / 6e-51 AT2G40780 197 / 4e-65 Nucleic acid-binding, OB-fold-like protein (.1.2)
Lus10012866 0 / 1 AT2G40780 51 / 3e-15 Nucleic acid-binding, OB-fold-like protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G061200 161 / 2e-51 AT2G40780 187 / 2e-61 Nucleic acid-binding, OB-fold-like protein (.1.2)
Potri.014G160900 39 / 0.0003 AT2G04520 200 / 3e-67 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.002G219200 38 / 0.0009 AT2G04520 198 / 2e-66 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF01176 eIF-1a Translation initiation factor 1A / IF-1
Representative CDS sequence
>Lus10030510 pacid=23140777 polypeptide=Lus10030510 locus=Lus10030510.g ID=Lus10030510.BGIv1.0 annot-version=v1.0
ATGAAGGCTGGAAGGAAGAATCTGAAGAGGACAGAATCAGAGGAACAAGGCTTGAAACTTGAAGATGGTCAAAGCATCATGCAGGTGTTGTCTCTCCGAG
GCTCCAATCTTATCGAGGTATTGGACCTGAATGGGGACAAGTCTTTAGCTTTGTTCCTTGCTAAGTTTCAGAAGACTATGTGGATCGAGAAAGAAGTGGG
AAGGCGATCTGAGTCGGGAAGCAAGGTGACTTGCATTGTTTCTCAGGTTCTCTTCCACGAACATGTCCGTACGCTTCAGAAATCGCCTGAATGGCCTGAA
GTCTTCAAAACCACAACCAATGGAACCTCTGATGCAAAAGGGACAGACCAAGAAGCAAAGGATCTCGATTCAAGTGACGATGATGATGGGCTCCCGCCAC
TGAAAGCCAACATGAACAGGATCCAGCCTCCATTTCTAGAAGCTGATTCAGATACAGGATTTGATTCTGATTCTTAG
AA sequence
>Lus10030510 pacid=23140777 polypeptide=Lus10030510 locus=Lus10030510.g ID=Lus10030510.BGIv1.0 annot-version=v1.0
MKAGRKNLKRTESEEQGLKLEDGQSIMQVLSLRGSNLIEVLDLNGDKSLALFLAKFQKTMWIEKEVGRRSESGSKVTCIVSQVLFHEHVRTLQKSPEWPE
VFKTTTNGTSDAKGTDQEAKDLDSSDDDDGLPPLKANMNRIQPPFLEADSDTGFDSDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G40780 Nucleic acid-binding, OB-fold-... Lus10030510 0 1
Lus10002099 2.4 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10005495 3.5 1.0000
Lus10025316 4.0 1.0000
Lus10011594 4.2 1.0000
AT5G39200 unknown protein Lus10030710 5.0 1.0000
AT1G64660 ATMGL methionine gamma-lyase (.1) Lus10033233 6.3 1.0000
AT4G17920 RING/U-box superfamily protein... Lus10030972 6.5 1.0000
AT2G42850 CYP718 "cytochrome P450, family 718",... Lus10031391 7.0 1.0000
AT1G61290 ATSYP124, SYP12... syntaxin of plants 124 (.1) Lus10006735 7.9 1.0000
AT5G53820 Late embryogenesis abundant pr... Lus10003056 8.1 0.8712

Lus10030510 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.