Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40770 48 / 2e-07 zinc ion binding;DNA binding;helicases;ATP binding;nucleic acid binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012867 [exp] 160 / 1e-46 AT2G40770 1843 / 0.0 zinc ion binding;DNA binding;helicases;ATP binding;nucleic acid binding (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G060900 [exp] 68 / 2e-14 AT2G40770 1921 / 0.0 zinc ion binding;DNA binding;helicases;ATP binding;nucleic acid binding (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030511 pacid=23140549 polypeptide=Lus10030511 locus=Lus10030511.g ID=Lus10030511.BGIv1.0 annot-version=v1.0 ATGGGTAGAAAAAAGCAATCCAGGCCTCATAGGTCTGGTGGTCTGATCATACAACCCAGTGAAGCTGCTTCTGGATCAGAATTTGAGAAAGGAAATGCTA CTGAAGAAGCTGAGGCTACAGAACAGAAAGATGAGCCCTTTTTTATTCAAGTGGATAGAACTGAGTGGAGTTCAGTGGAGCACTTTGATCTTGCTGAAGT TGTTCTTACCAGTTTGTGTTTAGGCGAACGATATCATACTTTCCAACAGATGTCAATTTTTATCACGAATCGAAGTACTCCTTACGGATACGGGTTTCCA ATCTTAATGATGGAGCTCTTAATGGTATAA
AA sequence Show only first row Show all	>Lus10030511 pacid=23140549 polypeptide=Lus10030511 locus=Lus10030511.g ID=Lus10030511.BGIv1.0 annot-version=v1.0 MGRKKQSRPHRSGGLIIQPSEAASGSEFEKGNATEEAEATEQKDEPFFIQVDRTEWSSVEHFDLAEVVLTSLCLGERYHTFQQMSIFITNRSTPYGYGFP ILMMELLMV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40770			zinc ion binding;DNA binding;h...		Lus10030511 [exp]	0	1
AT2G42920			Pentatricopeptide repeat (PPR-...		Lus10020764 [exp]	9.4	0.7554
AT1G69020			Prolyl oligopeptidase family p...		Lus10004631 [exp]	22.6	0.7508
					Lus10008296 [exp]	32.0	0.6729
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10037073 [exp]	43.7	0.6981
AT4G35290		ATGLUR2, ATGLR3...	GLUTAMATE RECEPTOR 3.2, glutam...		Lus10026552 [exp]	52.0	0.6925
AT3G03773			HSP20-like chaperones superfam...		Lus10010669 [exp]	61.8	0.6862
AT3G58590			Pentatricopeptide repeat (PPR)...		Lus10020139 [exp]	66.5	0.6629
AT3G51150			ATP binding microtubule motor ...		Lus10010624 [exp]	80.8	0.6443
AT1G78840			F-box/RNI-like/FBD-like domain...		Lus10008295 [exp]	91.4	0.6678
AT1G23790			Plant protein of unknown funct...		Lus10030619 [exp]	94.0	0.6682

Compare expression of checked genes

Lus10030511 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.