Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52130 114 / 3e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G07450 108 / 4e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 41 / 9e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48485 40 / 2e-05 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032575 [exp] 43 / 2e-06 AT5G55410 73 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10016582 [exp] 41 / 2e-05 AT5G55410 81 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10038233 [exp] 38 / 0.0003 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025866 [exp] 38 / 0.0003 AT5G48490 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G271000 [exp] 130 / 1e-40 AT3G52130 127 / 4e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G149900 [exp] 40 / 2e-05 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G112553 [exp] 39 / 0.0001 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.T125404 [exp] 39 / 0.0001 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G251000 [exp] 38 / 0.0001 AT5G48485 76 / 2e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G119000 [exp] 38 / 0.0004 AT1G62790 90 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10030541 pacid=23140738 polypeptide=Lus10030541 locus=Lus10030541.g ID=Lus10030541.BGIv1.0 annot-version=v1.0 ATGAAGAGAGTAGCAATCGCGGTCGTAGTAATGGCGATGATGTGGACCGTGGCGGCCGGATTCAGAGAAGAAGGGAAGCTAGGATCCACCTGCGGGAGCA CGTTCTTCTCCGCACTGGTGCAGCTAATACCGTGTAGGGCAGCAGTGGCACCCTTCAGCCCGATTCCTCCGAGTGATGGATGCTGCAATGCCCTCAAGTC CCTGGGACAGCCTTGCCTCTGTGTTCTTGTCAATGGTCCTCCAATTTCGGGTGTCGATCGTAACATGGCCATGCTTCTCCCCGACAAGTGCTCCGTCTCC TTCGATCCTTGTATGCTTTTTCGCTGA
AA sequence Show only first row Show all	>Lus10030541 pacid=23140738 polypeptide=Lus10030541 locus=Lus10030541.g ID=Lus10030541.BGIv1.0 annot-version=v1.0 MKRVAIAVVVMAMMWTVAAGFREEGKLGSTCGSTFFSALVQLIPCRAAVAPFSPIPPSDGCCNALKSLGQPCLCVLVNGPPISGVDRNMAMLLPDKCSVS FDPCMLFR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07450			Bifunctional inhibitor/lipid-t...		Lus10030541 [exp]	0	1
AT1G31860		HISN2, AT-IE	HISTIDINE BIOSYNTHESIS 2, hist...		Lus10043483 [exp]	12.4	0.6109
AT1G60730			NAD(P)-linked oxidoreductase s...		Lus10037408 [exp]	20.1	0.5917
					Lus10005172 [exp]	20.6	0.5059
AT3G13400		SKS13	SKU5 similar 13 (.1)		Lus10036492 [exp]	22.3	0.6027
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10038667 [exp]	27.3	0.5837
					Lus10005647 [exp]	28.2	0.5866
AT4G36050			endonuclease/exonuclease/phosp...		Lus10041907 [exp]	62.8	0.5582
AT3G42150			unknown protein		Lus10031451 [exp]	63.5	0.5544
AT4G10620			P-loop containing nucleoside t...		Lus10000122 [exp]	67.7	0.5511
AT3G07130		ATPAP15, PAP15	purple acid phosphatase 15 (.1...		Lus10007117 [exp]	73.7	0.5431

Compare expression of checked genes

Lus10030541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.