Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45820 111 / 4e-30 PKS18, CIPK20, SnRK3.6 SNF1-RELATED PROTEIN KINASE 3.6, PROTEIN KINASE 18, CBL-interacting protein kinase 20 (.1) AT5G01810 108 / 4e-29 ATPK10, SnRK3.1, SIP2, PKS3, CIPK15 SNF1-RELATED PROTEIN KINASE 3.1, SOS3-INTERACTING PROTEIN 2, PROTEIN KINASE 10, CBL-interacting protein kinase 15 (.1.2.3) AT5G58380 108 / 1e-28 PKS2, CIPK10, SnRK3.8, SIP1 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) AT5G07070 106 / 4e-28 CIPK2, SnRK3.2 SNF1-RELATED PROTEIN KINASE 3.2, CBL-interacting protein kinase 2 (.1) AT5G45810 105 / 1e-27 CIPK19, SnRK3.5 SNF1-RELATED PROTEIN KINASE 3.5, CBL-interacting protein kinase 19 (.1) AT5G25110 101 / 3e-26 CIPK25, SnRK3.25 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1) AT4G18700 101 / 5e-26 ATWL4, CIPK12, SnRK3.9 SNF1-RELATED PROTEIN KINASE 3.9, WPL4-LIKE 4, CBL-interacting protein kinase 12 (.1) AT1G29230 100 / 9e-26 ATCIPK18, ATWL1, CIPK18, SnRK3.20 SNF1-RELATED PROTEIN KINASE 3.20, WPL4-LIKE 1, CBL-interacting protein kinase 18 (.1) AT2G34180 100 / 9e-26 ATWL2, CIPK13, SnRK3.7 SNF1-RELATED PROTEIN KINASE 3.7, WPL4-LIKE 2, CBL-interacting protein kinase 13 (.1) AT4G14580 96 / 4e-24 CIPK4, SnRK3.3 SNF1-RELATED PROTEIN KINASE 3.3, CBL-interacting protein kinase 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012893 [exp] 225 / 3e-73 AT5G58380 446 / 3e-154 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Lus10029054 [exp] 140 / 9e-41 AT5G58380 483 / 4e-169 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Lus10034212 [exp] 137 / 7e-40 AT5G45820 473 / 5e-166 SNF1-RELATED PROTEIN KINASE 3.6, PROTEIN KINASE 18, CBL-interacting protein kinase 20 (.1) Lus10014163 [exp] 120 / 2e-33 AT5G58380 592 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Lus10022749 [exp] 120 / 3e-33 AT5G58380 598 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Lus10042229 [exp] 114 / 4e-31 AT5G58380 676 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Lus10022748 [exp] 114 / 5e-31 AT2G30360 491 / 3e-173 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1) Lus10025396 [exp] 103 / 2e-29 AT2G34180 198 / 1e-62 SNF1-RELATED PROTEIN KINASE 3.7, WPL4-LIKE 2, CBL-interacting protein kinase 13 (.1) Lus10029232 [exp] 101 / 2e-27 AT4G18700 466 / 3e-165 SNF1-RELATED PROTEIN KINASE 3.9, WPL4-LIKE 4, CBL-interacting protein kinase 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G048800 [exp] 125 / 5e-35 AT5G58380 539 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.016G133500 [exp] 123 / 4e-34 AT5G58380 593 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.013G156000 [exp] 114 / 5e-31 AT5G58380 623 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.019G127500 [exp] 114 / 7e-31 AT5G58380 641 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.011G067500 [exp] 111 / 5e-30 AT5G45820 647 / 0.0 SNF1-RELATED PROTEIN KINASE 3.6, PROTEIN KINASE 18, CBL-interacting protein kinase 20 (.1) Potri.011G067600 [exp] 102 / 3e-26 AT4G18700 720 / 0.0 SNF1-RELATED PROTEIN KINASE 3.9, WPL4-LIKE 4, CBL-interacting protein kinase 12 (.1) Potri.004G058300 [exp] 100 / 1e-25 AT4G18700 735 / 0.0 SNF1-RELATED PROTEIN KINASE 3.9, WPL4-LIKE 4, CBL-interacting protein kinase 12 (.1) Potri.006G263500 [exp] 94 / 1e-23 AT5G25110 568 / 0.0 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1) Potri.018G108500 [exp] 94 / 2e-23 AT4G30960 639 / 0.0 SNF1-RELATED PROTEIN KINASE 3.14, CBL-INTERACTING PROTEIN KINASE 6, SOS3-interacting protein 3 (.1) Potri.006G062800 [exp] 93 / 4e-23 AT1G30270 753 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10030545 pacid=23140582 polypeptide=Lus10030545 locus=Lus10030545.g ID=Lus10030545.BGIv1.0 annot-version=v1.0 ATGCAGGAAACGTGTAATGGAAGCCTGCCAGCTCATGTAGAACCTATTCGGTGTGTTAAAAAGAACTCTTCACTGGAAATGGAGAACAATGGGACCAAAA TTTTGATGGAGAGGTATGAAGTCGGCAGGCTGCTAGGCCAAGGCCAATTCGCCAAAGTCCACTACGCTCGAGACCTCCAAACCGGAAACAGTGTAGCAAT CAAGGTAATCGACAAGGAAAAGGCTCAGAAAGCAGGACTAACCACCACCAACATCAAGCAAGAGATCCACATCATGAGACTCGTTCACCAACACAAAAAC ATGTTGCACCTCTACGAAGTCCTGGCCTCGAAAACGAAGATCTACTTCGTCCTCGAGTACGCCAAGGTGTGA
AA sequence Show only first row Show all	>Lus10030545 pacid=23140582 polypeptide=Lus10030545 locus=Lus10030545.g ID=Lus10030545.BGIv1.0 annot-version=v1.0 MQETCNGSLPAHVEPIRCVKKNSSLEMENNGTKILMERYEVGRLLGQGQFAKVHYARDLQTGNSVAIKVIDKEKAQKAGLTTTNIKQEIHIMRLVHQHKN MLHLYEVLASKTKIYFVLEYAKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01810		ATPK10, SnRK3.1...	SNF1-RELATED PROTEIN KINASE 3....		Lus10030545 [exp]	0	1
AT1G15910		FDM1	factor of DNA methylation 1, X...		Lus10040287 [exp]	7.8	0.8619
AT4G05160			AMP-dependent synthetase and l...		Lus10021431 [exp]	8.9	0.8069
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Lus10011998 [exp]	12.7	0.8611
AT3G18060			transducin family protein / WD...		Lus10032444 [exp]	13.0	0.8596
AT3G56570			SET domain-containing protein ...		Lus10029539 [exp]	18.3	0.8579
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Lus10004239 [exp]	21.8	0.8575
AT4G00050	bHLH	bHLH016, UNE10	unfertilized embryo sac 10, ba...		Lus10015734 [exp]	23.5	0.8567
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036819 [exp]	26.5	0.8564
AT5G02890			HXXXD-type acyl-transferase fa...		Lus10000592 [exp]	27.2	0.8534
AT4G25800			Calmodulin-binding protein (.1...		Lus10020686 [exp]	28.2	0.8488

Compare expression of checked genes

Lus10030545 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.