Lus10030565 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04645 87 / 1e-22 Plant self-incompatibility protein S1 family (.1)
AT3G16970 83 / 4e-21 Plant self-incompatibility protein S1 family (.1)
AT5G12070 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
AT5G12060 81 / 3e-20 Plant self-incompatibility protein S1 family (.1)
AT4G16195 80 / 1e-19 Plant self-incompatibility protein S1 family (.1)
AT4G24974 77 / 7e-19 Plant self-incompatibility protein S1 family (.1)
AT4G24975 76 / 2e-18 Plant self-incompatibility protein S1 family (.1)
AT4G24973 73 / 4e-17 Plant self-incompatibility protein S1 family (.1)
AT3G17080 71 / 3e-16 Plant self-incompatibility protein S1 family (.1)
AT1G26798 70 / 1e-15 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030964 97 / 2e-26 AT5G12060 102 / 2e-28 Plant self-incompatibility protein S1 family (.1)
Lus10030965 94 / 5e-25 AT3G16970 89 / 2e-23 Plant self-incompatibility protein S1 family (.1)
Lus10011753 90 / 1e-22 AT3G16970 90 / 1e-22 Plant self-incompatibility protein S1 family (.1)
Lus10011069 85 / 1e-21 AT4G16195 89 / 2e-23 Plant self-incompatibility protein S1 family (.1)
Lus10011068 83 / 6e-21 AT4G16195 103 / 5e-29 Plant self-incompatibility protein S1 family (.1)
Lus10008107 82 / 2e-20 AT4G16195 98 / 1e-26 Plant self-incompatibility protein S1 family (.1)
Lus10000480 78 / 2e-19 AT5G12060 84 / 7e-22 Plant self-incompatibility protein S1 family (.1)
Lus10013145 76 / 7e-18 AT4G16195 88 / 8e-23 Plant self-incompatibility protein S1 family (.1)
Lus10023675 64 / 2e-13 AT3G24060 162 / 3e-52 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G148630 87 / 2e-22 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.018G148700 84 / 5e-21 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 82 / 9e-21 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.017G144361 83 / 1e-20 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 71 / 2e-16 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 70 / 8e-16 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.001G053100 63 / 3e-13 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 61 / 3e-12 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 60 / 4e-12 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 54 / 8e-10 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10030565 pacid=23140654 polypeptide=Lus10030565 locus=Lus10030565.g ID=Lus10030565.BGIv1.0 annot-version=v1.0
ATGGAGATCCAGAACAGCATGATATTTCCACCAACCCTCCTCCTCCTCATCATCATAATGACGATATCACCCTCGACGGCGCCCAATCCACCGTCACCTT
CGCCGATGAAGTGGACGCCGTTCCCGAAGAAGACGGTGACGTTGGCGAACGAGCTGACGAGCCACGACGTGCTGGAGATCCGGTGCAGGTCGAAAGACGA
CGATCTGGGAAAGCACACATTGAAGAAGAAGGACAATTTCCATTGGAGATTCCACAACAGCGCGTGGGGGAACACACTCTTCTACTGCTCGTTCCAGTGG
GGGGAAGGGGTCCGCTGGTTTGACGTCTACGTTCAGGAGAGGGACACCGCGCGTTGCGTTCACTGCAATTGGAGCGTTAAGGAGACGGGGCCTTGCTTGA
GTAATAACCATGAGAGTTGGAGAGCTTGTTATAAATGGAACAAATCGTGA
AA sequence
>Lus10030565 pacid=23140654 polypeptide=Lus10030565 locus=Lus10030565.g ID=Lus10030565.BGIv1.0 annot-version=v1.0
MEIQNSMIFPPTLLLLIIIMTISPSTAPNPPSPSPMKWTPFPKKTVTLANELTSHDVLEIRCRSKDDDLGKHTLKKKDNFHWRFHNSAWGNTLFYCSFQW
GEGVRWFDVYVQERDTARCVHCNWSVKETGPCLSNNHESWRACYKWNKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16970 Plant self-incompatibility pro... Lus10030565 0 1
AT4G35980 unknown protein Lus10042598 1.4 0.8483
AT5G58610 PHD finger transcription facto... Lus10018681 5.3 0.8323
AT4G16480 ATINT4 inositol transporter 4 (.1) Lus10038808 6.3 0.7534
AT3G14470 NB-ARC domain-containing disea... Lus10022900 7.1 0.7860
AT5G22260 MS1 male sterility 1, RING/FYVE/PH... Lus10030773 7.7 0.8091
AT3G47600 MYB ATMYB94, AtMYBC... myb domain protein 94 (.1) Lus10005245 10.1 0.7698
AT2G23570 ATMES19 ARABIDOPSIS THALIANA METHYL ES... Lus10020004 11.7 0.8188
AT4G26120 Ankyrin repeat family protein ... Lus10024843 16.5 0.7178
AT5G02130 NDP1 Tetratricopeptide repeat (TPR)... Lus10023783 22.4 0.7507
AT1G79800 AtENODL7 early nodulin-like protein 7 (... Lus10018758 26.5 0.7628

Lus10030565 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.