Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13590 35 / 0.0008 ATPSK1 phytosulfokine 1 precursor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030916 [exp] 125 / 2e-39 AT1G13590 56 / 8e-12 phytosulfokine 1 precursor (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06404 [flax] [poplar] PSK Phytosulfokine precursor protein (PSK)
Representative CDS sequence Show only first row Show all	>Lus10030572 pacid=23140633 polypeptide=Lus10030572 locus=Lus10030572.g ID=Lus10030572.BGIv1.0 annot-version=v1.0 ATGGCTGGAAAATCTGGGCATTTCTTTGTATTAACGATGGTTATTCTTAGTCTAGCATTGGTCACAGTACTGTCTGCAGAAGCCATCCGGCAATCAGCAC CTGAACCAGACCCAACTCCTGAGATGGAGTATTATGAGGATGGTGGGTGTGCAGGGAGAGGGGGTGAAGAAGGGTGTTTGATGAGGAGGTTCATGGCTGT TGCTCACACTGATTACATCTACACTCAAGATGTCAATGTTCATGACCCTTGA
AA sequence Show only first row Show all	>Lus10030572 pacid=23140633 polypeptide=Lus10030572 locus=Lus10030572.g ID=Lus10030572.BGIv1.0 annot-version=v1.0 MAGKSGHFFVLTMVILSLALVTVLSAEAIRQSAPEPDPTPEMEYYEDGGCAGRGGEEGCLMRRFMAVAHTDYIYTQDVNVHDP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G13590		ATPSK1	phytosulfokine 1 precursor (.1...		Lus10030572 [exp]	0	1
AT1G44970			Peroxidase superfamily protein...		Lus10010634 [exp]	3.2	0.9049
AT1G13590		ATPSK1	phytosulfokine 1 precursor (.1...		Lus10030916 [exp]	5.8	0.8700
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Lus10039133 [exp]	17.4	0.8587
AT5G48130			Phototropic-responsive NPH3 fa...		Lus10001164 [exp]	26.7	0.8381
AT5G49960			unknown protein		Lus10035805 [exp]	28.2	0.8555
AT4G14640		CAM8, AtCML8	calmodulin-like 8, calmodulin ...		Lus10004088 [exp]	29.3	0.8392
AT5G36930			Disease resistance protein (TI...		Lus10006928 [exp]	31.3	0.8486
					Lus10038309 [exp]	32.5	0.8336
AT5G05390		LAC12	laccase 12 (.1)		Lus10042252 [exp]	35.7	0.8461
AT4G30200		VEL1, VIL2	VIN3-Like 2, vernalization5/VI...		Lus10038260 [exp]	40.2	0.8470

Compare expression of checked genes

Lus10030572 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.