Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52400 74 / 9e-17 ATBG1, BGLU18, BGL1 BETA-GLUCOSIDASE HOMOLOG 1, A. THALIANA BETA-GLUCOSIDASE 1, beta glucosidase 18 (.1.2.3) AT5G36890 73 / 1e-16 BGLU42 beta glucosidase 42 (.1.2) AT5G24550 73 / 1e-16 BGLU32 beta glucosidase 32 (.1) AT1G75940 72 / 2e-16 BGLU20, ATA27 BETA GLUCOSIDASE 20, Glycosyl hydrolase superfamily protein (.1) AT1G61820 72 / 3e-16 BGLU46 beta glucosidase 46 (.1.3) AT5G24540 72 / 3e-16 BGLU31 beta glucosidase 31 (.1) AT1G26560 71 / 1e-15 BGLU40 beta glucosidase 40 (.1) AT2G44490 70 / 1e-15 BGLU26, PEN2 PENETRATION 2, BETA GLUCOSIDASE 26, Glycosyl hydrolase superfamily protein (.1) AT3G18070 70 / 1e-15 BGLU43 beta glucosidase 43 (.1.2) AT2G44450 69 / 3e-15 BGLU15 beta glucosidase 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030577 [exp] 148 / 1e-43 AT5G24550 461 / 2e-157 beta glucosidase 32 (.1) Lus10030518 [exp] 148 / 1e-43 AT5G24550 485 / 3e-167 beta glucosidase 32 (.1) Lus10030911 [exp] 148 / 1e-43 AT5G24550 475 / 1e-163 beta glucosidase 32 (.1) Lus10012869 [exp] 146 / 7e-43 AT5G24550 467 / 4e-160 beta glucosidase 32 (.1) Lus10030515 [exp] 145 / 7e-43 AT2G44450 281 / 4e-89 beta glucosidase 15 (.1) Lus10039513 [exp] 146 / 8e-43 AT2G44480 472 / 3e-162 beta glucosidase 17 (.1.2) Lus10012871 [exp] 144 / 2e-41 AT5G24550 466 / 1e-157 beta glucosidase 32 (.1) Lus10030516 [exp] 142 / 2e-41 AT2G44480 476 / 4e-164 beta glucosidase 17 (.1.2) Lus10012868 [exp] 141 / 1e-40 AT5G24550 435 / 1e-145 beta glucosidase 32 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G015100 [exp] 74 / 6e-17 AT5G44640 553 / 0.0 beta glucosidase 13 (.1) Potri.004G109699 [exp] 74 / 6e-17 AT5G44640 288 / 5e-94 beta glucosidase 13 (.1) Potri.004G110691 [exp] 74 / 8e-17 AT2G44480 524 / 0.0 beta glucosidase 17 (.1.2) Potri.004G110620 [exp] 74 / 8e-17 AT5G42260 525 / 0.0 beta glucosidase 12 (.1) Potri.004G109166 [exp] 74 / 8e-17 AT5G42260 525 / 0.0 beta glucosidase 12 (.1) Potri.001G222704 [exp] 74 / 1e-16 AT2G44480 526 / 0.0 beta glucosidase 17 (.1.2) Potri.001G222900 [exp] 74 / 1e-16 AT2G44480 526 / 0.0 beta glucosidase 17 (.1.2) Potri.001G223300 [exp] 74 / 1e-16 AT2G44480 529 / 0.0 beta glucosidase 17 (.1.2) Potri.001G222904 [exp] 74 / 1e-16 AT2G44480 531 / 0.0 beta glucosidase 17 (.1.2) Potri.010G178800 [exp] 73 / 1e-16 AT5G36890 714 / 0.0 beta glucosidase 42 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00232 [flax] [poplar] Glyco_hydro_1 Glycosyl hydrolase family 1
Representative CDS sequence Show only first row Show all	>Lus10030575 pacid=23140550 polypeptide=Lus10030575 locus=Lus10030575.g ID=Lus10030575.BGIv1.0 annot-version=v1.0 ATGGCTGAGTCGGAGGTGAATGTGAAAGGGTTTTTTGCATGGTCGTACATCGACAACTTCGAATGGAACGAAGGATACACTGTCAGGTTCGGGTTGTACT ACATCAACTACACCGATCTCACCAGACACCCAAAGTACTCTGCTTGCTGGTACACCGGTTTCTGTAACAAGACCCAACCCAAGTCTCAGTTAGAGTACTT TGATCTTGATCAACTCATCGCTACACGTGCTGCTGCTATCAATGGCCGTCGGGCTCTCTCCTCCGCCAACCACCTTTAG
AA sequence Show only first row Show all	>Lus10030575 pacid=23140550 polypeptide=Lus10030575 locus=Lus10030575.g ID=Lus10030575.BGIv1.0 annot-version=v1.0 MAESEVNVKGFFAWSYIDNFEWNEGYTVRFGLYYINYTDLTRHPKYSACWYTGFCNKTQPKSQLEYFDLDQLIATRAAAINGRRALSSANHL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52400		ATBG1, BGLU18, ...	BETA-GLUCOSIDASE HOMOLOG 1, A....		Lus10030575 [exp]	0	1
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10009321 [exp]	1.4	0.9614
AT2G16600		ROC3	rotamase CYP 3 (.1.2)		Lus10013552 [exp]	2.4	0.9592
					Lus10033847 [exp]	3.9	0.9531
AT2G39840		TOPP4	type one serine/threonine prot...		Lus10011827 [exp]	4.6	0.9450
AT1G63310			unknown protein		Lus10033253 [exp]	5.5	0.9469
AT1G63310			unknown protein		Lus10008287 [exp]	5.7	0.9522
					Lus10018997 [exp]	7.3	0.9428
AT1G29300		UNE1	unfertilized embryo sac 1, Pla...		Lus10015232 [exp]	8.0	0.9153
					Lus10032860 [exp]	8.1	0.9493
AT5G63710			Leucine-rich repeat protein ki...		Lus10035959 [exp]	8.9	0.9437

Compare expression of checked genes

Lus10030575 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.