Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21950 69 / 6e-15 SKIP6 SKP1 interacting partner 6 (.1) AT4G19250 44 / 2e-06 Galactose oxidase/kelch repeat superfamily protein (.1) AT3G27910 43 / 9e-06 Galactose oxidase/kelch repeat superfamily protein (.1) AT5G28160 43 / 1e-05 Galactose oxidase/kelch repeat superfamily protein (.1) AT4G19865 41 / 5e-05 Galactose oxidase/kelch repeat superfamily protein (.1) AT4G11770 40 / 6e-05 Galactose oxidase/kelch repeat superfamily protein (.1) AT4G39600 40 / 6e-05 Galactose oxidase/kelch repeat superfamily protein (.1) AT4G39550 40 / 7e-05 Galactose oxidase/kelch repeat superfamily protein (.1) AT3G08810 40 / 8e-05 Galactose oxidase/kelch repeat superfamily protein (.1) AT4G19870 40 / 0.0001 Galactose oxidase/kelch repeat superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030883 [exp] 139 / 9e-43 AT2G21950 214 / 2e-68 SKP1 interacting partner 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G081100 [exp] 94 / 4e-24 AT2G21950 390 / 3e-135 SKP1 interacting partner 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030606 pacid=23140701 polypeptide=Lus10030606 locus=Lus10030606.g ID=Lus10030606.BGIv1.0 annot-version=v1.0 ATGCAGGGGTTTGATTTCGACGCTGGTGGTGGGAGGGGAATGTGGAAGGAGGTGAGAGGGCTGGAGAGGAGGCTGCCGAGGTATTTGGTCGGAGCGACGA TGGCGAATGTGGGAGGGAAGTTGATGGTGGTTTGGGAAGGGATGGTGATAGGGAGGAGGATGGAGATTTGGTGCGTTGAGATTGAGCTGGAGAAGAGAGG AGGAGGAGAAGGAGGCGAATTATGGGGGAATGTTATCTGGTGTGATGTGGTTTGTAAGGTTCCTGCTGGGTCTTCCATTGTTCATTGCTTGGATGTGACT CTGTGA
AA sequence Show only first row Show all	>Lus10030606 pacid=23140701 polypeptide=Lus10030606 locus=Lus10030606.g ID=Lus10030606.BGIv1.0 annot-version=v1.0 MQGFDFDAGGGRGMWKEVRGLERRLPRYLVGATMANVGGKLMVVWEGMVIGRRMEIWCVEIELEKRGGGEGGELWGNVIWCDVVCKVPAGSSIVHCLDVT L

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21950		SKIP6	SKP1 interacting partner 6 (.1...		Lus10030606 [exp]	0	1
AT1G07950		MED22B	Surfeit locus protein 5 subuni...		Lus10023466 [exp]	4.2	0.8286
AT5G02530			RNA-binding (RRM/RBD/RNP motif...		Lus10040851 [exp]	6.0	0.8221
AT5G08630			DDT domain-containing protein ...		Lus10029550 [exp]	8.0	0.8105
AT3G14080			Small nuclear ribonucleoprotei...		Lus10008124 [exp]	8.7	0.8183
AT5G24600			Protein of unknown function, D...		Lus10015590 [exp]	10.2	0.7881
AT3G51810		AT3, GEA1, ATEM...	GUANINE NUCLEOTIDE EXCHANGE FA...		Lus10005044 [exp]	11.7	0.7284
AT3G58480			calmodulin-binding family prot...		Lus10029323 [exp]	11.7	0.7666
AT1G26750			unknown protein		Lus10031376 [exp]	15.6	0.7866
AT2G34930			disease resistance family prot...		Lus10016342 [exp]	16.5	0.7504
AT5G19950			Domain of unknown function (DU...		Lus10000162 [exp]	16.6	0.7851

Compare expression of checked genes

Lus10030606 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.