Lus10030607 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09690 295 / 4e-104 Translation protein SH3-like family protein (.1)
AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
AT1G57860 290 / 3e-102 Translation protein SH3-like family protein (.1)
AT1G57660 290 / 3e-102 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030882 336 / 3e-120 AT1G09690 296 / 2e-104 Translation protein SH3-like family protein (.1)
Lus10016241 323 / 2e-115 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10029302 320 / 4e-114 AT1G09690 294 / 1e-103 Translation protein SH3-like family protein (.1)
Lus10021079 298 / 2e-105 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Lus10017232 298 / 2e-105 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G195400 303 / 2e-107 AT1G57860 305 / 5e-108 Translation protein SH3-like family protein (.1)
Potri.016G061100 301 / 1e-106 AT1G57860 305 / 7e-108 Translation protein SH3-like family protein (.1)
Potri.003G159500 296 / 2e-104 AT1G09690 305 / 4e-108 Translation protein SH3-like family protein (.1)
Potri.001G071100 291 / 2e-102 AT1G09690 307 / 7e-109 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01157 Ribosomal_L21e Ribosomal protein L21e
Representative CDS sequence
>Lus10030607 pacid=23140767 polypeptide=Lus10030607 locus=Lus10030607.g ID=Lus10030607.BGIv1.0 annot-version=v1.0
ATGCCGGCTGGACATGGTCTCCGTTCCAGAACTCGAGATCTCTTCTCGAGGCCATTCAGGAAGAAGGGTTACATCCCGTTGACCACCTACCTCAGGACCT
ACAAGGTCGGCGACTATGTCGACGTTAAGGTGAATGGCGCCATCCACAAGGGTATGCCTCATAAGTTCTACCACGGCCGCACCGGTCGCGTCTGGAACGT
CACCAAGCGCGCCATCGGCGTTGAGATGAACAAGCAGGTTCGTGGCAAGATCCTAAAGAAGAGGATCCATGTCCGGATCGAGCACGTTCTGCCATCAAGG
TGCACTGAGGAGCTCTCCCTCAGGAAGAAGAAGAACGACGAGCTGAAGGCAGCTGCCAAGGCAAGAGGTGAGGTGATCAGCACCAAGAGGCAACCACAGG
GTCCCAAGCCTGGTTTCATGGTTGAAGGTGGTATTACTTTGGAGACTGTCACTCCCATCCCTTACGATGTTACCAACGATCTCAAGGGTGGTTACTAG
AA sequence
>Lus10030607 pacid=23140767 polypeptide=Lus10030607 locus=Lus10030607.g ID=Lus10030607.BGIv1.0 annot-version=v1.0
MPAGHGLRSRTRDLFSRPFRKKGYIPLTTYLRTYKVGDYVDVKVNGAIHKGMPHKFYHGRTGRVWNVTKRAIGVEMNKQVRGKILKKRIHVRIEHVLPSR
CTEELSLRKKKNDELKAAAKARGEVISTKRQPQGPKPGFMVEGGITLETVTPIPYDVTNDLKGGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09590 Translation protein SH3-like f... Lus10030607 0 1
AT3G11940 AML1, ATRPS5A ARABIDOPSIS MINUTE-LIKE 1, rib... Lus10008436 2.0 0.9818
AT5G35530 Ribosomal protein S3 family pr... Lus10030503 3.2 0.9750
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10015841 3.5 0.9733
AT2G20450 Ribosomal protein L14 (.1) Lus10011807 4.9 0.9662
AT1G67430 Ribosomal protein L22p/L17e fa... Lus10006421 5.0 0.9719
AT4G16720 Ribosomal protein L23/L15e fam... Lus10007805 6.0 0.9724
AT3G53740 Ribosomal protein L36e family ... Lus10024402 6.5 0.9714
AT3G16780 Ribosomal protein L19e family ... Lus10038417 6.5 0.9492
AT5G24510 60S acidic ribosomal protein f... Lus10028876 7.7 0.9560
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 7.9 0.9686

Lus10030607 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.