Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030844 [exp] 101 / 2e-29 AT1G23965 48 / 2e-08 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030641 pacid=23140717 polypeptide=Lus10030641 locus=Lus10030641.g ID=Lus10030641.BGIv1.0 annot-version=v1.0 ATGGCCGTTACTACCACTCCGGCGACGGTGAGCAACAAAACCAAGAGCAGGCTACTCAGGAGAAGAAGATCCGTCGCACTACTAAGGAATCGACGCAGCA GCAACGCCGTCGGAGGAGGGAGGAAGACGGCGGTGGGGATGAAGGTGAAGAAACTGAGAAAGCTAATCCCGCTGAGGAAACTAATCCCCGGAGGCGAAGG GATGGAGGCGGATCGGTTTCTTTTGAACACCGCCGATTATATATTGCATCTGAGGTTTCAACTCCACGTTTTGCAGTCCCTTTCCAACATTGTTCAGTAA
AA sequence Show only first row Show all	>Lus10030641 pacid=23140717 polypeptide=Lus10030641 locus=Lus10030641.g ID=Lus10030641.BGIv1.0 annot-version=v1.0 MAVTTTPATVSNKTKSRLLRRRRSVALLRNRRSSNAVGGGRKTAVGMKVKKLRKLIPLRKLIPGGEGMEADRFLLNTADYILHLRFQLHVLQSLSNIVQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G23965			unknown protein		Lus10030641 [exp]	0	1
AT1G71680			Transmembrane amino acid trans...		Lus10008263 [exp]	2.0	0.9388
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10024834 [exp]	2.8	0.9096
AT5G57970			DNA glycosylase superfamily pr...		Lus10038388 [exp]	5.9	0.8891
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10010148 [exp]	6.3	0.8599
AT3G45600		TET3	tetraspanin3 (.1)		Lus10023218 [exp]	6.7	0.9066
AT5G19580			glyoxal oxidase-related protei...		Lus10043230 [exp]	7.2	0.8986
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008996 [exp]	7.7	0.8868
AT4G29310			Protein of unknown function (D...		Lus10034991 [exp]	9.6	0.8557
AT1G76190			SAUR-like auxin-responsive pro...		Lus10021825 [exp]	10.4	0.7651
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10023977 [exp]	11.5	0.8842

Compare expression of checked genes

Lus10030641 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.