Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17960 146 / 9e-43 Threonyl-tRNA synthetase (.1) AT5G26830 144 / 3e-41 Threonyl-tRNA synthetase (.1) AT2G04842 102 / 4e-26 EMB2761 EMBRYO DEFECTIVE 2761, threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative (.1) AT1G18130 87 / 1e-22 Class II aaRS and biotin synthetases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030843 [exp] 223 / 8e-75 AT5G26830 248 / 2e-77 Threonyl-tRNA synthetase (.1) Lus10021402 [exp] 166 / 3e-49 AT5G26830 1093 / 0.0 Threonyl-tRNA synthetase (.1) Lus10005351 [exp] 166 / 5e-49 AT5G26830 1088 / 0.0 Threonyl-tRNA synthetase (.1) Lus10030841 [exp] 162 / 1e-47 AT5G26830 1007 / 0.0 Threonyl-tRNA synthetase (.1) Lus10030645 [exp] 156 / 3e-45 AT5G26830 946 / 0.0 Threonyl-tRNA synthetase (.1) Lus10012360 [exp] 103 / 9e-27 AT2G04842 1035 / 0.0 EMBRYO DEFECTIVE 2761, threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative (.1) Lus10006406 [exp] 45 / 1e-06 AT2G04842 203 / 6e-63 EMBRYO DEFECTIVE 2761, threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G096500 [exp] 163 / 4e-49 AT5G26830 827 / 0.0 Threonyl-tRNA synthetase (.1) Potri.008G145600 [exp] 166 / 5e-49 AT5G26830 1100 / 0.0 Threonyl-tRNA synthetase (.1) Potri.014G162200 [exp] 103 / 1e-26 AT2G04842 1089 / 0.0 EMBRYO DEFECTIVE 2761, threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030644 pacid=23140729 polypeptide=Lus10030644 locus=Lus10030644.g ID=Lus10030644.BGIv1.0 annot-version=v1.0 ATGAAAGAAGTGTTGGACGAGTTTGGGAACCCGTGGCAGAAAGATGAAGGCAATGGTGCCTTCTACGGTCCTAGGATAGATATTATTGTTTCCGATGCAT TGAAAAGGAAACACGAGTTTGCCAAATTGCAGCTCGACTTCCAGCTTCAGGATATTTTCAAGTTGAAGTACTCAGGAAAGGATGGACAACAGTTAGAAAG TCCAGTGATGATACACACGACCATCGTTGGCTCATTGGAGCGTATGTGTGCTTTACTGCTGGAGCACTACAGGGGAAATTGGCCTTTTTGGTTAAGTCCT CGTCTAGTAATCGTCTGCCCTTTCTCCGCCGAATATAAGGACTATGCTAAACAAGTAAGTTGTTCTGTCCTGCAGCTGCTCAGTCTCATATAA
AA sequence Show only first row Show all	>Lus10030644 pacid=23140729 polypeptide=Lus10030644 locus=Lus10030644.g ID=Lus10030644.BGIv1.0 annot-version=v1.0 MKEVLDEFGNPWQKDEGNGAFYGPRIDIIVSDALKRKHEFAKLQLDFQLQDIFKLKYSGKDGQQLESPVMIHTTIVGSLERMCALLLEHYRGNWPFWLSP RLVIVCPFSAEYKDYAKQVSCSVLQLLSLI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17960			Threonyl-tRNA synthetase (.1)		Lus10030644 [exp]	0	1
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Lus10039713 [exp]	1.0	0.9948
AT5G52390			PAR1 protein (.1)		Lus10016450 [exp]	1.4	0.9760
AT5G13240			transcription regulators (.1)		Lus10034638 [exp]	2.0	0.9744
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10001914 [exp]	3.5	0.9744
					Lus10020641 [exp]	3.9	0.9742
AT5G41020	MYB		myb family transcription facto...		Lus10022932 [exp]	5.3	0.9695
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10006244 [exp]	5.5	0.9740
AT5G10520		RBK1	ROP binding protein kinases 1 ...		Lus10002659 [exp]	6.3	0.9624
AT5G18470			Curculin-like (mannose-binding...		Lus10003099 [exp]	7.3	0.9622
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10022114 [exp]	10.5	0.9558

Compare expression of checked genes

Lus10030644 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.