Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030838 [exp] 133 / 5e-41 ND / Lus10029185 [exp] 62 / 6e-13 AT1G24020 80 / 2e-19 MLP-like protein 423 (.1.2) Lus10010701 [exp] 62 / 6e-13 AT1G24020 80 / 3e-19 MLP-like protein 423 (.1.2) Lus10029183 [exp] 61 / 2e-12 AT1G24020 73 / 6e-16 MLP-like protein 423 (.1.2) Lus10010700 [exp] 59 / 6e-12 AT1G24020 74 / 4e-17 MLP-like protein 423 (.1.2) Lus10030840 [exp] 53 / 9e-10 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2) Lus10030646 [exp] 50 / 2e-08 AT1G24020 189 / 3e-62 MLP-like protein 423 (.1.2) Lus10029182 [exp] 48 / 3e-07 AT1G24020 88 / 1e-20 MLP-like protein 423 (.1.2) Lus10010698 [exp] 47 / 5e-07 AT1G24020 94 / 2e-22 MLP-like protein 423 (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10030647 pacid=23140706 polypeptide=Lus10030647 locus=Lus10030647.g ID=Lus10030647.BGIv1.0 annot-version=v1.0 ATGGTCATTGTAGGTACGCATCGGCGTTGGAAGAATTGGGTGGAGCAAATAATCCGAGTCGATCATGAGAAGAAGACGATAGATTTATCGGCGGTGCGTG GAGGTCCGTTGAATGAATGCGGCATATTCAAGACAACGGCGACGGTGAGGCCTATGATGAGCAGTCCTAATAGCCCCGGAGCAATGGTGAAATGGACGTG CCGTTACACCAACTCATCGGGTGGGTTTCAAGTGAAGGACATGAAGGATTTTGTGGAATCTTCGTTCAGGAAATTGGATAATCTTCTACTCCGGGACGCC GAAAGGGAGATGCGCAAGCCACCAAACATGGTACGGCGCCGTAACTAG
AA sequence Show only first row Show all	>Lus10030647 pacid=23140706 polypeptide=Lus10030647 locus=Lus10030647.g ID=Lus10030647.BGIv1.0 annot-version=v1.0 MVIVGTHRRWKNWVEQIIRVDHEKKTIDLSAVRGGPLNECGIFKTTATVRPMMSSPNSPGAMVKWTCRYTNSSGGFQVKDMKDFVESSFRKLDNLLLRDA EREMRKPPNMVRRRN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030647 [exp]	0	1
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001042 [exp]	3.7	0.7743
AT5G17730			P-loop containing nucleoside t...		Lus10041778 [exp]	5.1	0.7073
AT5G53040		GRD, RKD4	RWP-RK domain-containing 4, GR...		Lus10005921 [exp]	11.1	0.7495
					Lus10001144 [exp]	21.4	0.7491
AT1G31260		ZIP10	zinc transporter 10 precursor ...		Lus10040615 [exp]	33.5	0.7374
					Lus10003448 [exp]	37.8	0.7027
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001032 [exp]	40.0	0.6992
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001041 [exp]	67.3	0.6777
					Lus10030648 [exp]	67.5	0.7174
AT3G18670			Ankyrin repeat family protein ...		Lus10019888 [exp]	76.7	0.6986

Compare expression of checked genes

Lus10030647 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.