Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14520 464 / 4e-165 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G33700 456 / 9e-162 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT1G47330 350 / 1e-118 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT5G52790 347 / 7e-118 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G14240 317 / 3e-106 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) AT1G03270 308 / 3e-102 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G14230 307 / 3e-102 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT1G55930 60 / 6e-10 CBS domain-containing protein / transporter associated domain-containing protein (.1) AT3G13070 56 / 2e-08 CBS domain-containing protein / transporter associated domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005259 [exp] 536 / 0 AT2G14520 679 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10012476 [exp] 456 / 4e-161 AT2G14520 591 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10020494 [exp] 431 / 2e-152 AT2G14520 538 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10027528 [exp] 369 / 3e-126 AT5G52790 560 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10039289 [exp] 366 / 3e-125 AT5G52790 557 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10032715 [exp] 364 / 2e-124 AT1G47330 646 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10034024 [exp] 330 / 5e-111 AT4G14230 675 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10012375 [exp] 326 / 2e-109 AT1G03270 627 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10028010 [exp] 324 / 9e-109 AT1G03270 635 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G288000 [exp] 486 / 2e-173 AT2G14520 620 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.009G082300 [exp] 474 / 7e-169 AT2G14520 593 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.014G012400 [exp] 440 / 3e-155 AT2G14520 516 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.017G147900 [exp] 380 / 4e-130 AT5G52790 580 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.014G196900 [exp] 363 / 2e-123 AT1G47330 575 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.010G030200 [exp] 330 / 8e-111 AT4G14240 611 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) Potri.008G202100 [exp] 329 / 1e-110 AT4G14240 632 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) Potri.002G260401 [exp] 54 / 2e-09 AT1G47330 58 / 3e-11 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.001G362100 [exp] 57 / 7e-09 AT1G55930 858 / 0.0 CBS domain-containing protein / transporter associated domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01595 [flax] [poplar] DUF21 Cyclin M transmembrane N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10030665 pacid=23155356 polypeptide=Lus10030665 locus=Lus10030665.g ID=Lus10030665.BGIv1.0 annot-version=v1.0 ATGGCGGTGGAGTATAGCTGCTGCAGCTCCGATTTCTTCATCCACATTGCGGTAATCACGCTGCTGGTGCTGTTCGCCGGGATGATGTCCGGACTAACTT TGGGTCTCATGTCTATGAGTCTCGTCGATCTCGAAGTCCTCGCCAAATCCGGCACTCCTCAGGATCGGAAACACGCTAAAAAGATACTGCCAGTTGTCAA AAATCAACATTTGTTACTCTGTACACTGCTGATTTGCAATGCCGCTGCTATGGAGGCACTCCCTATTTTCCTTGACAGCCTGATAACAGCATGGGGTGCT ATCCTGATTTCTGTTACTCTGATTCTGCTCTTTGGTGAGATAATACCACAATCTATTTGCACCAGATATGGTCTGGCAATTGGTGCCACGATGTCCCCTG TTGTTCGAGTGCTGGTTTGGATATGCTTTCCAGTTGCCTATCCAATAAGCAAGCTTCTAGATTATCTGCTGGGTCATGGGCATGTCGCTCTTTTCCGCAG AGCTGAGTTGAAGACCCTTGTGAATTTTCACGGTAACGAGGCAGGAAAAGGTGGAGAGCTGACTCACGATGAGACAACGATTATAGCCGGAGCACTTGAG CTCACTGAAAAAACAGCCAGTGATGCTATGACTCCCATCTCTGAAACGTTTGCCATTGATATCAATGGCAAGCTTGACAGTGATCTGATGAATTTGATTC TGGAGAATGGACACAGCAGAGTGCCTGTGTATTACGAACAACCTACCAACATTATCGGCCTTGTTTTGGTGAAGAATCTGTTAACCATCCACCCTGAAGA TGCCACACCTGTAAAGAACGTGACCATTCGAAGAATCCCCAGGCCAACAATATCTGTTCAATGA
AA sequence Show only first row Show all	>Lus10030665 pacid=23155356 polypeptide=Lus10030665 locus=Lus10030665.g ID=Lus10030665.BGIv1.0 annot-version=v1.0 MAVEYSCCSSDFFIHIAVITLLVLFAGMMSGLTLGLMSMSLVDLEVLAKSGTPQDRKHAKKILPVVKNQHLLLCTLLICNAAAMEALPIFLDSLITAWGA ILISVTLILLFGEIIPQSICTRYGLAIGATMSPVVRVLVWICFPVAYPISKLLDYLLGHGHVALFRRAELKTLVNFHGNEAGKGGELTHDETTIIAGALE LTEKTASDAMTPISETFAIDINGKLDSDLMNLILENGHSRVPVYYEQPTNIIGLVLVKNLLTIHPEDATPVKNVTIRRIPRPTISVQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14520			CBS domain-containing protein ...		Lus10030665 [exp]	0	1
AT3G54190			Transducin/WD40 repeat-like su...		Lus10003237 [exp]	1.0	0.8919
AT5G14620		DMT7, DRM2	domains rearranged methyltrans...		Lus10014552 [exp]	1.4	0.8682
AT4G04860		DER2.2	DERLIN-2.2 (.1)		Lus10007664 [exp]	3.5	0.8544
AT5G66460		MAN7, AtMAN7	endo-beta-mannase 7, Glycosyl ...		Lus10014288 [exp]	5.4	0.8197
AT5G63860		UVR8	UVB-RESISTANCE 8, Regulator of...		Lus10029536 [exp]	5.5	0.8544
AT4G30935	WRKY	ATWRKY32, WRKY3...	WRKY DNA-binding protein 32 (....		Lus10036268 [exp]	7.4	0.8433
AT2G40070			unknown protein		Lus10040188 [exp]	9.7	0.8306
AT3G17900			unknown protein		Lus10013273 [exp]	9.8	0.8345
AT1G23380	HD	KNAT6S, KNAT6L,...	KNOTTED1-like homeobox gene 6 ...		Lus10013037 [exp]	10.0	0.8436
AT5G61250		ATGUS1	glucuronidase 1 (.1.2)		Lus10037109 [exp]	11.1	0.8148

Compare expression of checked genes

Lus10030665 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.