Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39950 189 / 2e-63 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G19730 120 / 2e-36 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT1G59730 120 / 8e-36 ATH7 thioredoxin H-type 7 (.1) AT1G69880 119 / 2e-35 ATH8 thioredoxin H-type 8 (.1) AT1G45145 117 / 7e-35 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT3G51030 115 / 3e-34 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT5G42980 105 / 3e-30 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT3G56420 92 / 2e-24 Thioredoxin superfamily protein (.1) AT3G17880 94 / 1e-23 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT3G08710 81 / 2e-20 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005258 [exp] 264 / 7e-93 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10036696 [exp] 129 / 5e-39 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1) Lus10037228 [exp] 128 / 7e-39 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10037227 [exp] 128 / 1e-38 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1) Lus10036695 [exp] 124 / 3e-37 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10036698 [exp] 119 / 2e-35 AT1G69880 113 / 5e-33 thioredoxin H-type 8 (.1) Lus10037225 [exp] 117 / 1e-34 AT1G69880 115 / 8e-34 thioredoxin H-type 8 (.1) Lus10014277 [exp] 114 / 2e-33 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 111 / 1e-32 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G076700 [exp] 196 / 7e-66 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.008G194100 [exp] 120 / 8e-36 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.005G232700 [exp] 114 / 1e-33 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.007G018000 [exp] 110 / 3e-32 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 108 / 2e-31 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.015G036000 [exp] 97 / 9e-25 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.012G045000 [exp] 93 / 2e-23 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.006G110100 [exp] 84 / 1e-21 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.019G062000 [exp] 82 / 1e-20 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.016G138800 [exp] 81 / 2e-20 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10030666 pacid=23155377 polypeptide=Lus10030666 locus=Lus10030666.g ID=Lus10030666.BGIv1.0 annot-version=v1.0 ATGGGTGGCTTTCTATCTTCCTTAGTTGGCGGAGAATCCGCCGCCGCCGGAGAAGAATCAGACGATTACGCCGGAGTCACCAAGTTCCACTCAGACGCCA GGTGGCAGCTCCACTTCAACTCGCTCAAAGACTCAAACCAGCTACTGGTGATTGATTTCGCTGCATCCTGGTGCGGTCCTTGCCGATTCATAGAGCCGGC CGTTAATGACATGGCTGATAAATTCTCCGACGTCTCCTTCGCCAAGATCGATGTCGATGAATTGCCCGGTGTGTCGAAGGAATTTGGGGTGCAGGCGATG CCGACGTTTGTGTTGGTGAAGCGAGGGAAGGAAGTGGACAGGGTGGTGGGAGCTAAAAAAGATGAGCTTGAGAAGAAGGTTGCTAAGTACAGGTCTGCCT GA
AA sequence Show only first row Show all	>Lus10030666 pacid=23155377 polypeptide=Lus10030666 locus=Lus10030666.g ID=Lus10030666.BGIv1.0 annot-version=v1.0 MGGFLSSLVGGESAAAGEESDDYAGVTKFHSDARWQLHFNSLKDSNQLLVIDFAASWCGPCRFIEPAVNDMADKFSDVSFAKIDVDELPGVSKEFGVQAM PTFVLVKRGKEVDRVVGAKKDELEKKVAKYRSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G39950		ATTRXH2, ATTRX2...	Arabidopsis thioredoxin h2, th...		Lus10030666 [exp]	0	1
AT3G60540			Preprotein translocase Sec, Se...		Lus10010009 [exp]	2.2	0.9132
AT5G63910		FCLY	farnesylcysteine lyase (.1)		Lus10010948 [exp]	3.3	0.8892
AT5G04750			F1F0-ATPase inhibitor protein,...		Lus10034146 [exp]	5.7	0.8948
AT5G13160		PBS1	avrPphB susceptible 1, Protein...		Lus10015756 [exp]	7.7	0.8706
AT1G10150		ATPP2-A10	Carbohydrate-binding protein (...		Lus10039651 [exp]	7.9	0.8819
					Lus10034731 [exp]	8.7	0.9006
AT4G08230			glycine-rich protein (.1.2)		Lus10041619 [exp]	9.2	0.8951
AT4G05530		SDRA, IBR1	SHORT-CHAIN DEHYDROGENASE/REDU...		Lus10020019 [exp]	9.4	0.9027
AT1G79230		STR1, ATRDH1, A...	ARABIDOPSIS THALIANA RHODANESE...		Lus10031753 [exp]	10.6	0.8569
AT5G63030		GRXC1	glutaredoxin C1, Thioredoxin s...		Lus10001237 [exp]	11.2	0.8984

Compare expression of checked genes

Lus10030666 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.