Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015358 [exp] 103 / 4e-30 ND 42 / 3e-05 Lus10007266 [exp] 94 / 4e-26 ND / Lus10033018 [exp] 51 / 1e-08 AT5G15110 561 / 0.0 Pectate lyase family protein (.1) Lus10005254 [exp] 45 / 3e-06 AT3G01270 558 / 0.0 Pectate lyase family protein (.1) Lus10030670 [exp] 43 / 1e-05 AT3G01270 558 / 0.0 Pectate lyase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G124100 [exp] 69 / 1e-14 AT5G15110 533 / 0.0 Pectate lyase family protein (.1) Potri.017G078400 [exp] 58 / 5e-11 AT5G15110 481 / 7e-168 Pectate lyase family protein (.1) Potri.015G064700 [exp] 44 / 5e-06 AT5G15110 511 / 5e-180 Pectate lyase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04431 [flax] [poplar] Pec_lyase_N Pectate lyase, N terminus
Representative CDS sequence Show only first row Show all	>Lus10030669 pacid=23155318 polypeptide=Lus10030669 locus=Lus10030669.g ID=Lus10030669.BGIv1.0 annot-version=v1.0 ATGGAGGCATCATCAGCAAAGCTAGTCTTGATCTTTGCCTTGTTCTTAGGAACAATGATCCAAACCTTACACGCAGACGTCGGCGCATACGACGACGTTT GGCAGAAGCGTGCCCAGGAAGCCAAGAAGAAGACCATGGAAGCTTACATTCCTGACGTCATGGAAGTCAAAAACGGCCAAGTCGCCGGCACCGCCATCGT TTCCGTCACTTCTGCCGACGGCGAGGTCGAGGTGCCCGCCGCCAGTCCGGTCGCTGCTGCGCCGGGACCAGCACTTAACGGCGTTGGAGGGAGGAAGGTC ATGACACAAATATTGGAATAA
AA sequence Show only first row Show all	>Lus10030669 pacid=23155318 polypeptide=Lus10030669 locus=Lus10030669.g ID=Lus10030669.BGIv1.0 annot-version=v1.0 MEASSAKLVLIFALFLGTMIQTLHADVGAYDDVWQKRAQEAKKKTMEAYIPDVMEVKNGQVAGTAIVSVTSADGEVEVPAASPVAAAPGPALNGVGGRKV MTQILE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030669 [exp]	0	1
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10021136 [exp]	16.3	0.6971
AT3G10330			Cyclin-like family protein (.1...		Lus10016260 [exp]	20.0	0.6562
AT1G70780			unknown protein		Lus10009131 [exp]	45.2	0.6108
AT3G23560		ALF5	ABERRANT LATERAL ROOT FORMATIO...		Lus10034966 [exp]	45.5	0.6274
AT3G50930		BCS1	cytochrome BC1 synthesis (.1)		Lus10037004 [exp]	113.5	0.5647
AT5G02930			F-box/RNI-like superfamily pro...		Lus10040452 [exp]	120.9	0.5647
AT5G27700			Ribosomal protein S21e (.1)		Lus10010971 [exp]	126.9	0.5886
AT4G05130		ATENT4	equilibrative nucleoside trans...		Lus10002590 [exp]	134.7	0.5622
AT1G76810			eukaryotic translation initiat...		Lus10023474 [exp]	204.1	0.5486
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	223.1	0.5440

Compare expression of checked genes

Lus10030669 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.