Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005247 [exp] 88 / 2e-24 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G122800 [exp] 44 / 3e-07 ND / Potri.017G084700 [exp] 42 / 2e-06 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030676 pacid=23155279 polypeptide=Lus10030676 locus=Lus10030676.g ID=Lus10030676.BGIv1.0 annot-version=v1.0 ATGGGTAGTAGCAGCAGCTTTGCTCCTCTGTTACTAGTTCTGCTTCTCCTGCTTCCATCCCACGGCTTTATTGTTGGTAGAAAGATGGCTGGTGGGTTCG GACTAGTGGATGCGTTCGGGGAGGAATCAAGGGAGCTATCGGAGGAATCGATCGATTACCAGCTAGATCCGGAGCCCAACACGAATCCGAGAAACGGGTT CGTGTATCCTCCTCCGACCGATGCACCGCCTCCGGTTCCTGACTGGTGA
AA sequence Show only first row Show all	>Lus10030676 pacid=23155279 polypeptide=Lus10030676 locus=Lus10030676.g ID=Lus10030676.BGIv1.0 annot-version=v1.0 MGSSSSFAPLLLVLLLLLPSHGFIVGRKMAGGFGLVDAFGEESRELSEESIDYQLDPEPNTNPRNGFVYPPPTDAPPPVPDW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030676 [exp]	0	1
AT3G05390			unknown protein		Lus10004494 [exp]	4.2	0.9069
AT1G05030			Major facilitator superfamily ...		Lus10030010 [exp]	8.3	0.8964
AT1G03220			Eukaryotic aspartyl protease f...		Lus10021936 [exp]	8.5	0.9061
AT3G46170			NAD(P)-binding Rossmann-fold s...		Lus10006696 [exp]	10.9	0.8676
AT4G01470		ATTIP1.3, GAMMA...	tonoplast intrinsic protein 1;...		Lus10005885 [exp]	11.4	0.8760
AT3G56230			BTB/POZ domain-containing prot...		Lus10010216 [exp]	18.8	0.8939
AT5G05340			Peroxidase superfamily protein...		Lus10008581 [exp]	19.6	0.8705
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10032282 [exp]	22.1	0.8873
AT5G67070		RALFL34	ralf-like 34 (.1)		Lus10001132 [exp]	23.6	0.8719
					Lus10002087 [exp]	26.1	0.8792

Compare expression of checked genes

Lus10030676 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.