Lus10030678 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007187 259 / 5e-91 ND /
Lus10001550 194 / 1e-65 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G185732 222 / 2e-76 ND /
PFAM info
Representative CDS sequence
>Lus10030678 pacid=23155368 polypeptide=Lus10030678 locus=Lus10030678.g ID=Lus10030678.BGIv1.0 annot-version=v1.0
ATGATAGGAAGAGCCGACATCGAAGGATCAAAAAGCAACGTCGCTATGAACGCTTGCCTGCCACAAGCCAGTTATCCCTGTGGTAACTTTTCTGACACCT
CTAGCTTCAAATTCCGAAGGTCTAAAGGATCGATAGGCCACGCTTTCACGGTTCGTATTCGTACTGGAAATCAGAATCAAACGAGCTTTTACCCTTTTGT
TCCACACGAGATTTCTGTTCTCGTTGAGCTCATCTTAGGACACCTGCGTTATCTTTTAACAGATGTGCCGCCCCAGCCAAACTCCCCACCTGACAATGTC
TTCCGCCCGGATCGGCCCGCCGAACGGCCTTTGGAGCTCCCACTTATACTACACCTCTCAAGTCATTTCACAAAGTCGGACTAG
AA sequence
>Lus10030678 pacid=23155368 polypeptide=Lus10030678 locus=Lus10030678.g ID=Lus10030678.BGIv1.0 annot-version=v1.0
MIGRADIEGSKSNVAMNACLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNV
FRPDRPAERPLELPLILHLSSHFTKSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10030678 0 1
Lus10007187 1.0 0.9981
AT1G11340 S-locus lectin protein kinase ... Lus10002717 1.4 0.9806
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10016229 2.6 0.7759
Lus10001550 3.0 0.9559
Lus10008011 5.3 0.8647
Lus10000298 15.7 0.8298
AT4G27410 NAC RD26, ANAC072 NAC (No Apical Meristem) domai... Lus10003458 20.8 0.7090
Lus10000299 21.5 0.7111
Lus10039450 25.0 0.7459
Lus10016961 26.2 0.7236

Lus10030678 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.