Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15230 116 / 3e-35 GASA4 GAST1 protein homolog 4 (.1.2) AT1G74670 115 / 1e-34 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT2G30810 86 / 3e-23 Gibberellin-regulated family protein (.1) AT3G02885 84 / 2e-22 GASA5 GAST1 protein homolog 5 (.1) AT3G10185 75 / 9e-19 Gibberellin-regulated family protein (.1) AT1G10588 64 / 7e-15 Gibberellin-regulated family protein (.1.2) AT2G39540 64 / 1e-14 Gibberellin-regulated family protein (.1) AT5G59845 61 / 2e-13 Gibberellin-regulated family protein (.1) AT4G09600 61 / 3e-13 GASA3 GAST1 protein homolog 3 (.1) AT1G22690 58 / 5e-12 Gibberellin-regulated family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008612 [exp] 121 / 6e-37 AT1G74670 138 / 8e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10042203 [exp] 119 / 3e-36 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10002059 [exp] 115 / 1e-34 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10029340 [exp] 103 / 3e-30 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10018016 [exp] 99 / 6e-28 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10004048 [exp] 96 / 5e-27 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10024216 [exp] 94 / 1e-25 AT1G74670 106 / 1e-30 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10042012 [exp] 88 / 1e-23 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10001407 [exp] 69 / 2e-16 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G083000 [exp] 139 / 3e-44 AT5G15230 116 / 3e-35 GAST1 protein homolog 4 (.1.2) Potri.006G044400 [exp] 99 / 4e-28 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.001G254100 [exp] 99 / 6e-28 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 97 / 7e-28 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.001G315500 [exp] 95 / 1e-26 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.014G020100 [exp] 68 / 3e-16 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.013G113400 [exp] 64 / 7e-15 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 61 / 1e-13 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.001G297700 [exp] 61 / 1e-13 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.019G083900 [exp] 60 / 8e-13 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10030680 pacid=23155342 polypeptide=Lus10030680 locus=Lus10030680.g ID=Lus10030680.BGIv1.0 annot-version=v1.0 ATGGCCAAGTTGCTTGCCGTATTCCTCTTGGCCCTCATTGCTATCTCCACTCTCCAATCTGTGGTTATGGCTTCCCGTGGACGTGGTGGCCACCACTACG ACAACAAGAGGAAATTTGGGGAGGGCAGTTTGAAAAGCTACCAATGCCCATCTCGATGCTCGAAGAGGTGCAGCAAGACGCAGCACCACAAGCCGTGCAT GTTCTTCTGCCAAATGTGCTGCAGCAAATGCCTGTGCGTTCCTGGAGGTTACTACGGCAACAAGGCTGTTTGCCCTTGTTATAATAACTGGAAGACCCAG GAAGGAAAACCCAAATGTCCTTAA
AA sequence Show only first row Show all	>Lus10030680 pacid=23155342 polypeptide=Lus10030680 locus=Lus10030680.g ID=Lus10030680.BGIv1.0 annot-version=v1.0 MAKLLAVFLLALIAISTLQSVVMASRGRGGHHYDNKRKFGEGSLKSYQCPSRCSKRCSKTQHHKPCMFFCQMCCSKCLCVPGGYYGNKAVCPCYNNWKTQ EGKPKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G15230		GASA4	GAST1 protein homolog 4 (.1.2)		Lus10030680 [exp]	0	1
AT5G48670	MADS	FEM111, AGL80	AGAMOUS-like 80 (.1)		Lus10032108 [exp]	7.1	0.7826
AT3G14520		AtTPS18	Terpenoid cyclases/Protein pre...		Lus10002660 [exp]	8.1	0.8571
AT1G07290		GONST2	golgi nucleotide sugar transpo...		Lus10005865 [exp]	12.8	0.8339
AT1G19230			Riboflavin synthase-like super...		Lus10033423 [exp]	16.8	0.8265
					Lus10002087 [exp]	19.9	0.8426
AT2G27920		SCPL51	serine carboxypeptidase-like 5...		Lus10035555 [exp]	22.2	0.8138
AT1G17710		AtPEPC1	Arabidopsis thaliana phosphoet...		Lus10015634 [exp]	26.2	0.8315
AT1G13620		RGF2	root meristem growth factor 2,...		Lus10019202 [exp]	33.6	0.8016
AT5G65030			unknown protein		Lus10041694 [exp]	34.4	0.8270
AT3G02230		ATRGP1, RGP1	ARABIDOPSIS THALIANA REVERSIBL...		Lus10022443 [exp]	41.0	0.8185

Compare expression of checked genes

Lus10030680 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.