Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030682 pacid=23155220 polypeptide=Lus10030682 locus=Lus10030682.g ID=Lus10030682.BGIv1.0 annot-version=v1.0 ATGGACGGCGCCGGACATTGCAACGACAACCTAACGATACCTTTCATTCTCTCCTCAAACAGTGACACCAAAAACACCGACCGTTACGACAACGGCGGCG GCGGCGATGACCACAAACTACCACATTACCTCAACAGTACGACCGAAGGCGGCACCACCACTTTCTTCAGCACCTGCTTCAATGGCCTCAACGCCCTCTC AGTGGAGGCTATGCACTGCACTGCTGTCTAG
AA sequence Show only first row Show all	>Lus10030682 pacid=23155220 polypeptide=Lus10030682 locus=Lus10030682.g ID=Lus10030682.BGIv1.0 annot-version=v1.0 MDGAGHCNDNLTIPFILSSNSDTKNTDRYDNGGGGDDHKLPHYLNSTTEGGTTTFFSTCFNGLNALSVEAMHCTAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030682 [exp]	0	1
AT5G66750		CHR01, CHA1, SO...	SOMNIFEROUS 1, DECREASED DNA M...		Lus10041735 [exp]	6.9	0.9202
AT5G05510			Mad3/BUB1 homology region 1 (....		Lus10009836 [exp]	8.7	0.9190
AT5G48385			FRIGIDA-like protein (.1)		Lus10027765 [exp]	10.0	0.9066
AT1G01110		IQD18	IQ-domain 18 (.1.2)		Lus10008269 [exp]	10.2	0.9088
AT4G22860			Cell cycle regulated microtubu...		Lus10006677 [exp]	11.7	0.9185
AT4G33400			Vacuolar import/degradation, V...		Lus10042656 [exp]	11.9	0.9195
AT1G26760		SDG35, ATXR1	SET domain protein 35 (.1)		Lus10037155 [exp]	19.6	0.9135
AT2G32940		AGO6	ARGONAUTE 6, Argonaute family ...		Lus10035331 [exp]	20.5	0.8903
AT5G01910			unknown protein		Lus10022734 [exp]	22.5	0.9030
AT1G77720		PPK1	putative protein kinase 1 (.1)		Lus10025634 [exp]	24.0	0.9048

Compare expression of checked genes

Lus10030682 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.